BAK1 (англ. BCL2 antagonist/killer 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 211 амінокислот, а молекулярна маса — 23 409.
BAK1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | BAK1, BAK, BAK-LIKE, BCL2L7, CDN1, BCL2 antagonist/killer 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 600516 MGI: 1097161 HomoloGene: 917 GeneCards: BAK1 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
хронічний лімфолейкоз | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 6: 33.57 – 33.58 Mb | н/д | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MASGQGPGPP | RQECGEPALP | SASEEQVAQD | TEEVFRSYVF | YRHQQEQEAE | ||||
GVAAPADPEM | VTLPLQPSST | MGQVGRQLAI | IGDDINRRYD | SEFQTMLQHL | ||||
QPTAENAYEY | FTKIATSLFE | SGINWGRVVA | LLGFGYRLAL | HVYQHGLTGF | ||||
LGQVTRFVVD | FMLHHCIARW | IAQRGGWVAA | LNLGNGPILN | VLVVLGVVLL | ||||
GQFVVRRFFK | S |
Задіяний у таких біологічних процесах, як апоптоз, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у мембрані, мітохондрії.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Postigo A., Cross J.R., Downward J., Way M. (2006). Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. Cell Death Differ. 13: 1651—1662. PMID 16439990 DOI:10.1038/sj.cdd.4401853
Примітки
- Захворювання, генетично пов'язані з BAK1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 16 липня 2017. Процитовано 6 вересня 2017.
- (англ.) . Архів оригіналу за 16 жовтня 2017. Процитовано 6 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BAK1 angl BCL2 antagonist killer 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 211 aminokislot a molekulyarna masa 23 409 BAK1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB5AJK 1BXL 2IMS 2IMT 2JBY 2JCN 2LP8 2M5B 2XPX 3I1H 3QBR 4D2L 4U2U 4U2V 4UF1 5FMK 5FMIIdentifikatoriSimvoliBAK1 BAK BAK LIKE BCL2L7 CDN1 BCL2 antagonist killer 1Zovnishni ID OMIM 600516 MGI 1097161 HomoloGene 917 GeneCards BAK1Pov yazani genetichni zahvoryuvannyahronichnij limfolejkoz Ontologiya genaMolekulyarna funkciya transmembrane transporter binding zv yazuvannya z ionom metalu GO 0001948 GO 0016582 protein binding identical protein binding protein homodimerization activity molekulyarna funkciya heat shock protein binding protein heterodimerization activity chaperone binding BH domain bindingKlitinna komponenta integral component of membrane gialoplazma membrana mitohondrialna membrana integral component of mitochondrial outer membrane vnutrishnoklitinnij endoplazmatichnij retikulum mitohondriya pore complex mitohondrialna zovnishnya membrana BAK complexBiologichnij proces GO 1990613 mitochondrial fusion leukocyte homeostasis regulation of apoptotic process positive regulation of endoplasmic reticulum unfolded protein response establishment or maintenance of transmembrane electrochemical gradient limb morphogenesis positive regulation of calcium ion transport into cytosol GO 1904578 response to organic cyclic compound B cell apoptotic process regulation of protein heterodimerization activity positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway vagina development homeostasis of number of cells cellular response to UV myeloid cell homeostasis GO 0010260 starinnya lyudini post embryonic camera type eye morphogenesis B cell homeostasis thymocyte apoptotic process endoplasmic reticulum calcium ion homeostasis negative regulation of gene expression regulation of cell cycle regulation of mitochondrial membrane potential positive regulation of IRE1 mediated unfolded protein response blood vessel remodeling intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress brain development response to fungus regulation of mitochondrial membrane permeability cellular response to mechanical stimulus fibroblast apoptotic process activation of cysteine type endopeptidase activity apoptotic process involved in blood vessel morphogenesis activation of cysteine type endopeptidase activity involved in apoptotic process by cytochrome c animal organ regeneration negative regulation of peptidyl serine phosphorylation positive regulation of proteolysis positive regulation of release of cytochrome c from mitochondria apoptotic signaling pathway negative regulation of endoplasmic reticulum calcium ion concentration proliferaciya response to ethanol activation of cysteine type endopeptidase activity involved in apoptotic process response to gamma radiation regulation of protein homodimerization activity response to UV C response to hydrogen peroxide endocrine pancreas development release of cytochrome c from mitochondria B cell negative selection negative regulation of cell population proliferation response to mycotoxin positive regulation of apoptotic process intrinsic apoptotic signaling pathway in response to DNA damage extrinsic apoptotic signaling pathway in absence of ligand GO 0097285 apoptoz Unfolded Protein ResponseDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez578 12018Ensembl ENSG00000030110 ENSMUSG00000057789UniProt Q16611 O08734RefSeq mRNK NM 001188NM 007523RefSeq bilok NP 001179NP 031549Lokus UCSC Hr 6 33 57 33 58 Mbn dPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAE GVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL QPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGF LGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLL GQFVVRRFFKS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak apoptoz acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku Lokalizovanij u membrani mitohondriyi LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Postigo A Cross J R Downward J Way M 2006 Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia induced apoptosis Cell Death Differ 13 1651 1662 PMID 16439990 DOI 10 1038 sj cdd 4401853PrimitkiZahvoryuvannya genetichno pov yazani z BAK1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 16 lipnya 2017 Procitovano 6 veresnya 2017 angl Arhiv originalu za 16 zhovtnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi