AVPR1A (англ. Arginine vasopressin receptor 1A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 418 амінокислот, а молекулярна маса — 46 800.
AVPR1A | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | AVPR1A, AVPR V1a, AVPR1, V1aR, arginine vasopressin receptor 1A | ||||||||||||||||
Зовнішні ІД | OMIM: 600821 MGI: 1859216 HomoloGene: 568 GeneCards: AVPR1A | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
vasotocin, Окситоцин, вазопресин, conivaptan, mozavaptan, nelivaptan, relcovaptan, толваптан, вазопресин, selepressin, SRX246, десмопресин, LVP, conivaptan hydrochloride | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 12: 63.14 – 63.15 Mb | Хр. 10: 122.28 – 122.29 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MRLSAGPDAG | PSGNSSPWWP | LATGAGNTSR | EAEALGEGNG | PPRDVRNEEL | ||||
AKLEIAVLAV | TFAVAVLGNS | SVLLALHRTP | RKTSRMHLFI | RHLSLADLAV | ||||
AFFQVLPQMC | WDITYRFRGP | DWLCRVVKHL | QVFGMFASAY | MLVVMTADRY | ||||
IAVCHPLKTL | QQPARRSRLM | IAAAWVLSFV | LSTPQYFVFS | MIEVNNVTKA | ||||
RDCWATFIQP | WGSRAYVTWM | TGGIFVAPVV | ILGTCYGFIC | YNIWCNVRGK | ||||
TASRQSKGAE | QAGVAFQKGF | LLAPCVSSVK | SISRAKIRTV | KMTFVIVTAY | ||||
IVCWAPFFII | QMWSVWDPMS | VWTESENPTI | TITALLGSLN | SCCNPWIYMF | ||||
FSGHLLQDCV | QSFPCCQNMK | EKFNKEDTDS | MSRRQTFYSN | NRSPTNSTGM | ||||
WKDSPKSSKS | IKFIPVST |
Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, , фосфопротеїнів. Локалізований у клітинній мембрані, мембрані.
Література
- Hirasawa A., Shibata K., Kotosai K., Tsujimoto G. (1994). Cloning, functional expression and tissue distribution of human cDNA for the vascular-type vasopressin receptor. Biochem. Biophys. Res. Commun. 203: 72—79. PMID 8074728 DOI:10.1006/bbrc.1994.2150
- North W.G., Fay M.J., Longo K.A., Du J. (1997). Functional vasopressin V1 type receptors are present in variant as well as classical forms of small-cell carcinoma. Peptides. 18: 985—993. PMID 9357056 DOI:10.1016/S0196-9781(97)00072-7
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- North W.G., Fay M.J., Longo K.A., Du J. (1998). Expression of all known vasopressin receptor subtypes by small cell tumors implies a multifaceted role for this neuropeptide. Cancer Res. 58: 1866—1871. PMID 9581826
Примітки
- Сполуки, які фізично взаємодіють з Arginine vasopressin receptor 1A переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:895 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
AVPR1A angl Arginine vasopressin receptor 1A bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 418 aminokislot a molekulyarna masa 46 800 AVPR1ANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1YTVIdentifikatoriSimvoliAVPR1A AVPR V1a AVPR1 V1aR arginine vasopressin receptor 1AZovnishni ID OMIM 600821 MGI 1859216 HomoloGene 568 GeneCards AVPR1AReaguye na spolukuvasotocin Oksitocin vazopresin conivaptan mozavaptan nelivaptan relcovaptan tolvaptan vazopresin selepressin SRX246 desmopresin LVP conivaptan hydrochloride Ontologiya genaMolekulyarna funkciya signal transducer activity protein kinase C binding peptide hormone binding V1A vasopressin receptor binding G protein coupled receptor activity peptidnij zv yazok GO 0001948 GO 0016582 protein binding vasopressin receptor activityKlitinna komponenta integral component of membrane integral component of plasma membrane membrana GO 0016023 cytoplasmic vesicle endosoma klitinna membranaBiologichnij proces sim yaviporskuvannya telencephalon development negative regulation of female receptivity cellular response to hormone stimulus generation of precursor metabolites and energy krovoobig negative regulation of transmission of nerve impulse cellular response to water deprivation GO 0072468 signalna transdukciya activation of phospholipase C activity positive regulation of heart rate positive regulation of systemic arterial blood pressure response to corticosterone myotube differentiation positive regulation of prostaglandin biosynthetic process positive regulation of blood pressure positive regulation of cell growth erekciya penisa positive regulation of cellular pH reduction positive regulation of cell population proliferation socialna povedinka marafet response to inorganic substance calcium mediated signaling maternal aggressive behavior positive regulation of glutamate secretion response to organic substance response to peptide positive regulation of renal sodium excretion positive regulation of cytosolic calcium ion concentration G protein coupled receptor signaling pathway regulation of systemic arterial blood pressure by vasopressin maternal behavior positive regulation of vasoconstrictionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez552 54140Ensembl ENSG00000166148 ENSMUSG00000020123UniProt P37288 Q62463RefSeq mRNK NM 000706NM 016847RefSeq bilok NP 000697NP 058543Lokus UCSC Hr 12 63 14 63 15 MbHr 10 122 28 122 29 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEEL AKLEIAVLAVTFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAV AFFQVLPQMCWDITYRFRGPDWLCRVVKHLQVFGMFASAYMLVVMTADRY IAVCHPLKTLQQPARRSRLMIAAAWVLSFVLSTPQYFVFSMIEVNNVTKA RDCWATFIQPWGSRAYVTWMTGGIFVAPVVILGTCYGFICYNIWCNVRGK TASRQSKGAEQAGVAFQKGFLLAPCVSSVKSISRAKIRTVKMTFVIVTAY IVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMF FSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGM WKDSPKSSKSIKFIPVST A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv fosfoproteyiniv Lokalizovanij u klitinnij membrani membrani LiteraturaHirasawa A Shibata K Kotosai K Tsujimoto G 1994 Cloning functional expression and tissue distribution of human cDNA for the vascular type vasopressin receptor Biochem Biophys Res Commun 203 72 79 PMID 8074728 DOI 10 1006 bbrc 1994 2150 North W G Fay M J Longo K A Du J 1997 Functional vasopressin V1 type receptors are present in variant as well as classical forms of small cell carcinoma Peptides 18 985 993 PMID 9357056 DOI 10 1016 S0196 9781 97 00072 7 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 North W G Fay M J Longo K A Du J 1998 Expression of all known vasopressin receptor subtypes by small cell tumors implies a multifaceted role for this neuropeptide Cancer Res 58 1866 1871 PMID 9581826PrimitkiSpoluki yaki fizichno vzayemodiyut z Arginine vasopressin receptor 1A pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 895 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 12 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi