ATF4 (англ. Activating transcription factor 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми. Довжина поліпептидного ланцюга білка становить 351 амінокислот, а молекулярна маса — 38 590.
ATF4 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | ATF4, CREB-2, CREB2, TAXREB67, TXREB, activating transcription factor 4 | ||||||||||||||||
Зовнішні ІД | OMIM: 604064 MGI: 88096 HomoloGene: 1266 GeneCards: ATF4 | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 22: 39.52 – 39.52 Mb | Хр. 15: 80.14 – 80.14 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MTEMSFLSSE | VLVGDLMSPF | DQSGLGAEES | LGLLDDYLEV | AKHFKPHGFS | ||||
SDKAKAGSSE | WLAVDGLVSP | SNNSKEDAFS | GTDWMLEKMD | LKEFDLDALL | ||||
GIDDLETMPD | DLLTTLDDTC | DLFAPLVQET | NKQPPQTVNP | IGHLPESLTK | ||||
PDQVAPFTFL | QPLPLSPGVL | SSTPDHSFSL | ELGSEVDITE | GDRKPDYTAY | ||||
VAMIPQCIKE | EDTPSDNDSG | ICMSPESYLG | SPQHSPSTRG | SPNRSLPSPG | ||||
VLCGSARPKP | YDPPGEKMVA | AKVKGEKLDK | KLKKMEQNKT | AATRYRQKKR | ||||
AEQEALTGEC | KELEKKNEAL | KERADSLAKE | IQYLKDLIEE | VRKARGKKRV | ||||
P |
Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми. Білок має сайт для зв'язування з ДНК. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані.
Література
- Karpinski B.A., Morle G.D., Huggenvik J., Uhler M.D., Leiden J.M. (1992). Molecular cloning of human CREB-2: an ATF/CREB transcription factor that can negatively regulate transcription from the cAMP response element. Proc. Natl. Acad. Sci. U.S.A. 89: 4820—4824. PMID 1534408 DOI:10.1073/pnas.89.11.4820
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Hai T., Liu F., Coukos W.J., Green M.R. (1989). Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers. Genes Dev. 3: 2083—2090. PMID 2516827 DOI:10.1101/gad.3.12b.2083
- Ohoka N., Yoshii S., Hattori T., Onozaki K., Hayashi H. (2005). TRB3, a novel ER stress-inducible gene, is induced via ATF4-CHOP pathway and is involved in cell death. EMBO J. 24: 1243—1255. PMID 15775988 DOI:10.1038/sj.emboj.7600596
- Su N., Kilberg M.S. (2008). C/EBP homology protein (CHOP) interacts with activating transcription factor 4 (ATF4) and negatively regulates the stress-dependent induction of the asparagine synthetase gene. J. Biol. Chem. 283: 35106—35117. PMID 18940792 DOI:10.1074/jbc.M806874200
- Shoval Y., Berissi H., Kimchi A., Pietrokovski S. (2011). New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform. PLoS ONE. 6: E17344—E17344. PMID 21408167 DOI:10.1371/journal.pone.0017344
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:786 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 25 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
ATF4 angl Activating transcription factor 4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 22 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 351 aminokislot a molekulyarna masa 38 590 ATF4Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1CI6IdentifikatoriSimvoliATF4 CREB 2 CREB2 TAXREB67 TXREB activating transcription factor 4Zovnishni ID OMIM 604064 MGI 88096 HomoloGene 1266 GeneCards ATF4Ontologiya genaMolekulyarna funkciya DNA binding sequence specific DNA binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific transcription factor binding GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding core promoter sequence specific DNA binding protein C terminus binding GO 0001948 GO 0016582 protein binding leucine zipper domain binding protein heterodimerization activity protein kinase binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific RNA polymerase II transcription regulatory region sequence specific DNA bindingKlitinna komponenta citoplazma ATF1 ATF4 transcription factor complex ATF4 CREB1 transcription factor complex transcription regulator complex dendrite membrane klitinne yadro Lewy body core nuclear periphery membrana klitinna membrana nukleoplazma centr organizaciyi mikrotrubochok neuron projection citoskelet CHOP ATF4 complex centrosoma GO 0009327 protein containing complex RNA polymerase II transcription regulator complexBiologichnij proces gamma aminobutyric acid signaling pathway glyukoneogenez GO 0009373 regulation of transcription DNA templated positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II negative regulation of oxidative stress induced neuron death cellular response to amino acid starvation mRNA transcription by RNA polymerase II circadian regulation of gene expression response to endoplasmic reticulum stress PERK mediated unfolded protein response response to manganese induced endoplasmic reticulum stress GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of neuron apoptotic process intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress GO 1901313 positive regulation of gene expression positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress cirkadnij ritm negative regulation of potassium ion transport GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of transcription from RNA polymerase II promoter in response to arsenic containing substance cellular response to glucose starvation negative regulation of translational initiation in response to stress ritmichnij proces cellular response to UV positive regulation of transcription from RNA polymerase II promoter in response to stress cellular amino acid metabolic process transcription by RNA polymerase II transcription DNA templated positive regulation of apoptotic process positive regulation of vascular endothelial growth factor production positive regulation of transcription by RNA polymerase I cellular response to dopamine response to toxic substance neuron differentiation cellular response to oxygen glucose deprivation positive regulation of endoplasmic reticulum stress induced intrinsic apoptotic signaling pathway cellular calcium ion homeostasis positive regulation of biomineral tissue development negative regulation of cold induced thermogenesis positive regulation of vascular associated smooth muscle cell apoptotic process positive regulation of sodium dependent phosphate transportDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez468 11911Ensembl ENSG00000128272 ENSMUSG00000042406UniProt P18848 Q06507RefSeq mRNK NM 182810 NM 001675NM 001287180 NM 009716RefSeq bilok NP 001666 NP 877962NP 001274109 NP 033846Lokus UCSC Hr 22 39 52 39 52 MbHr 15 80 14 80 14 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFS SDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALL GIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTK PDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAY VAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPG VLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRV P A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi biologichni ritmi Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u klitinnij membrani citoplazmi citoskeleti yadri membrani LiteraturaKarpinski B A Morle G D Huggenvik J Uhler M D Leiden J M 1992 Molecular cloning of human CREB 2 an ATF CREB transcription factor that can negatively regulate transcription from the cAMP response element Proc Natl Acad Sci U S A 89 4820 4824 PMID 1534408 DOI 10 1073 pnas 89 11 4820 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hai T Liu F Coukos W J Green M R 1989 Transcription factor ATF cDNA clones an extensive family of leucine zipper proteins able to selectively form DNA binding heterodimers Genes Dev 3 2083 2090 PMID 2516827 DOI 10 1101 gad 3 12b 2083 Ohoka N Yoshii S Hattori T Onozaki K Hayashi H 2005 TRB3 a novel ER stress inducible gene is induced via ATF4 CHOP pathway and is involved in cell death EMBO J 24 1243 1255 PMID 15775988 DOI 10 1038 sj emboj 7600596 Su N Kilberg M S 2008 C EBP homology protein CHOP interacts with activating transcription factor 4 ATF4 and negatively regulates the stress dependent induction of the asparagine synthetase gene J Biol Chem 283 35106 35117 PMID 18940792 DOI 10 1074 jbc M806874200 Shoval Y Berissi H Kimchi A Pietrokovski S 2011 New modularity of DAP kinases alternative splicing of the DRP 1 gene produces a ZIPk like isoform PLoS ONE 6 E17344 E17344 PMID 21408167 DOI 10 1371 journal pone 0017344PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 786 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 25 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 22 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi