AKT1 (англ. AKT serine/threonine kinase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми. Довжина поліпептидного ланцюга білка становить 480 амінокислот, а молекулярна маса — 55 686.
AKT1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | AKT1, AKT, CWS6, PKB, PKB-ALPHA, PRKBA, RAC, RAC-ALPHA, AKT serine/threonine kinase 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 164730 MGI: 87986 HomoloGene: 3785 GeneCards: AKT1 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
колоректальний рак, Proteus syndrome, рак молочної залози, Cowden syndrome 1 | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
![]() | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 14: 104.77 – 104.8 Mb | Хр. 12: 112.62 – 112.64 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MSDVAIVKEG | WLHKRGEYIK | TWRPRYFLLK | NDGTFIGYKE | RPQDVDQREA | ||||
PLNNFSVAQC | QLMKTERPRP | NTFIIRCLQW | TTVIERTFHV | ETPEEREEWT | ||||
TAIQTVADGL | KKQEEEEMDF | RSGSPSDNSG | AEEMEVSLAK | PKHRVTMNEF | ||||
EYLKLLGKGT | FGKVILVKEK | ATGRYYAMKI | LKKEVIVAKD | EVAHTLTENR | ||||
VLQNSRHPFL | TALKYSFQTH | DRLCFVMEYA | NGGELFFHLS | RERVFSEDRA | ||||
RFYGAEIVSA | LDYLHSEKNV | VYRDLKLENL | MLDKDGHIKI | TDFGLCKEGI | ||||
KDGATMKTFC | GTPEYLAPEV | LEDNDYGRAV | DWWGLGVVMY | EMMCGRLPFY | ||||
NQDHEKLFEL | ILMEEIRFPR | TLGPEAKSLL | SGLLKKDPKQ | RLGGGSEDAK | ||||
EIMQHRFFAG | IVWQHVYEKK | LSPPFKPQVT | SETDTRYFDE | EFTAQMITIT | ||||
PPDQDDSMEC | VDSERRPHFP | QFSYSASGTA |
Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, , фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, регуляція трансляції, транспорт, вуглеводний обмін, метаболізм глікогену, нейрогенез, обмін глюкози, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані.
Література
- Jones P.F., Jakubowicz T., Pitossi F.J., Maurer F., Hemmings B.A. (1991). Molecular cloning and identification of a serine/threonine protein kinase of the second-messenger subfamily. Proc. Natl. Acad. Sci. U.S.A. 88: 4171—4175. PMID 1851997 DOI:10.1073/pnas.88.10.4171
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Coffer P.J., Woodgett J.R. (1991). Molecular cloning and characterisation of a novel putative protein-serine kinase related to the cAMP-dependent and protein kinase C families. Eur. J. Biochem. 201: 475—481. PMID 1718748 DOI:10.1111/j.1432-1033.1991.tb16305.x
- Du K., Montminy M. (1998). CREB is a regulatory target for the protein kinase Akt/PKB. J. Biol. Chem. 273: 32377—32379. PMID 9829964 DOI:10.1074/jbc.273.49.32377
- Rena G., Guo S., Cichy S.C., Unterman T.G., Cohen P. (1999). Phosphorylation of the transcription factor forkhead family member FKHR by protein kinase B. J. Biol. Chem. 274: 17179—17183. PMID 10358075 DOI:10.1074/jbc.274.24.17179
- Zimmermann S., Moelling K. (1999). Phosphorylation and regulation of Raf by Akt (protein kinase B). Science. 286: 1741—1744. PMID 10576742 DOI:10.1126/science.286.5445.1741
Примітки
- Захворювання, генетично пов'язані з AKT1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:391 (англ.) . Процитовано 11 вересня 2017.
{{}}
: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url () - UniProt, P31749 (англ.) . Архів оригіналу за 25 вересня 2017. Процитовано 11 вересня 2017.
Див. також
![]() | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
AKT1 angl AKT serine threonine kinase 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 480 aminokislot a molekulyarna masa 55 686 5 AKT1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1H10 1UNP 1UNQ 1UNR 2UVM 2UZR 2UZS 3CQU 3CQW 3MV5 3MVH 3O96 3OCB 3OW4 3QKK 3QKL 3QKM 4EJN 4EKK 4EKL 4GV1 5KCVIdentifikatoriSimvoliAKT1 AKT CWS6 PKB PKB ALPHA PRKBA RAC RAC ALPHA AKT serine threonine kinase 1Zovnishni ID OMIM 164730 MGI 87986 HomoloGene 3785 GeneCards AKT1Pov yazani genetichni zahvoryuvannyakolorektalnij rak Proteus syndrome rak molochnoyi zalozi Cowden syndrome 1 1 Ontologiya genaMolekulyarna funkciya GTPase activating protein binding kinase activity nitric oxide synthase regulator activity ATP binding protein kinase activity protein phosphatase 2A binding enzyme binding phosphatidylinositol 3 4 5 trisphosphate binding transferase activity 14 3 3 protein binding GO 0001948 GO 0016582 protein binding protein serine threonine tyrosine kinase activity protein kinase binding protein kinase C binding nucleotide binding phosphatidylinositol 3 4 bisphosphate binding identical protein binding protein serine threonine kinase activity protein homodimerization activity calmodulin bindingKlitinna komponenta citoplazma gialoplazma membrana cell cell junction mitohondriya klitinne yadro ciliary basal body microtubule cytoskeleton klitinna membrana vereteno podilu nukleoplazma vezikula postsynapse GO 0009327 protein containing complexBiologichnij proces germ cell development positive regulation of glucose import cellular response to nerve growth factor stimulus positive regulation of protein phosphorylation positive regulation of lipid biosynthetic process regulation of neuron projection development activation induced cell death of T cells response to heat regulation of cell cycle checkpoint response to organic substance response to insulin like growth factor stimulus positive regulation of endodeoxyribonuclease activity cellular response to DNA damage stimulus regulation of protein localization platelet activation protein phosphorylation cellular response to mechanical stimulus negative regulation of long chain fatty acid import across plasma membrane negative regulation of fatty acid beta oxidation cell projection organization cellular response to granulocyte macrophage colony stimulating factor stimulus positive regulation of blood vessel endothelial cell migration glucose metabolic process glycogen metabolic process regulation of glycogen biosynthetic process glycogen cell differentiation involved in embryonic placenta development proliferaciya negative regulation of autophagy cellular response to hypoxia negative regulation of cell size endocrine pancreas development GO 0006859 carbohydrate transport negative regulation of proteolysis insulin like growth factor receptor signaling pathway GO 0051247 GO 0051200 positive regulation of protein metabolic process positive regulation of glycogen biosynthetic process glucose homeostasis labyrinthine layer blood vessel development GO 0001306 response to oxidative stress negative regulation of gene expression positive regulation of peptidyl serine phosphorylation cellular response to prostaglandin E stimulus positive regulation of cell growth positive regulation of nitric oxide synthase activity maternal placenta development regulation of myelination Ubikvitin zalezhnij proteoliz positive regulation of vasoconstriction hyaluronan metabolic process spinal cord development cellular response to insulin stimulus cellular response to decreased oxygen levels protein autophosphorylation inflammatory response positive regulation of fat cell differentiation positive regulation of proteasomal ubiquitin dependent protein catabolic process negative regulation of neuron death G protein coupled receptor signaling pathway diferenciaciya klitin cellular response to peptide negative regulation of protein kinase activity fosforilyuvannya regulation of mRNA stability negative regulation of release of cytochrome c from mitochondria execution phase of apoptosis GO 1904579 cellular response to organic cyclic compound positive regulation of DNA binding transcription factor activity positive regulation of glucose metabolic process nejrobiologiya rozvitku response to fluid shear stress maintenance of protein location in mitochondrion GO 0044257 protein catabolic process negative regulation of protein kinase activity by protein phosphorylation osteoblast differentiation response to UV A response to hormone peptidyl threonine phosphorylation lipopolysaccharide mediated signaling pathway positive regulation of protein localization to nucleus negative regulation of cysteine type endopeptidase activity involved in apoptotic process GO 0007243 intracellular signal transduction regulation of cell migration peripheral nervous system myelin maintenance nitric oxide biosynthetic process positive regulation of endothelial cell proliferation Biosintez bilkiv positive regulation of nitric oxide biosynthetic process cellular response to growth factor stimulus T cell costimulation regulation of nitric oxide synthase activity GO 0010260 starinnya lyudini mammary gland epithelial cell differentiation cellular response to epidermal growth factor stimulus multicellular organism development negative regulation of JNK cascade glycogen biosynthetic process establishment of protein localization to mitochondrion apoptotic mitochondrial changes GO 0035404 peptidyl serine phosphorylation GO 0061423 positive regulation of sodium ion transport response to growth hormone positive regulation of apoptotic process response to food cellular response to vascular endothelial growth factor stimulus striated muscle cell differentiation negative regulation of oxidative stress induced intrinsic apoptotic signaling pathway negative regulation of extrinsic apoptotic signaling pathway in absence of ligand positive regulation of fibroblast migration regulation of translation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II GO 0072468 signalna transdukciya negative regulation of endopeptidase activity GO 0097285 apoptoz positive regulation of epidermal growth factor receptor signaling pathway interleukin 18 mediated signaling pathway GO 1901047 insulin receptor signaling pathway positive regulation of smooth muscle cell proliferation regulation of signal transduction by p53 class mediator negative regulation of macroautophagy TOR signaling anoikis positive regulation of organ growth I kappaB kinase NF kappaB signaling phosphatidylinositol 3 kinase signaling GO 0072353 cellular response to reactive oxygen species NIK NF kappaB signaling GO 0060469 GO 0009371 positive regulation of transcription DNA templated cellular response to cadmium ion positive regulation of I kappaB phosphorylation epidermal growth factor receptor signaling pathway positive regulation of cell population proliferation positive regulation of mitochondrial membrane potential regulation of apoptotic process negative regulation of apoptotic process positive regulation of protein localization to plasma membrane carbohydrate metabolic process activation of protein kinase B activity protein kinase B signaling negative regulation of protein kinase B signaling excitatory postsynaptic potential cellular response to tumor necrosis factor cell migration involved in sprouting angiogenesis GO 1901313 positive regulation of gene expression cytokine mediated signaling pathway negative regulation of protein ubiquitination negative regulation of protein binding positive regulation of cyclin dependent protein serine threonine kinase activity negative regulation of Notch signaling pathway negative regulation of protein serine threonine kinase activity cellular response to oxidised low density lipoprotein particle stimulus positive regulation of G1 S transition of mitotic cell cycle negative regulation of leukocyte cell cell adhesion positive regulation of protein localization to cell surface negative regulation of lymphocyte migration protein import into nucleusDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez207 11651Ensembl ENSG00000142208 ENSMUSG00000001729UniProt P31749 P31750RefSeq mRNK NM 001014431 NM 001014432 NM 005163 NM 001382430 NM 001382431NM 001382432 NM 001382433NM 001165894 NM 009652 NM 001331107RefSeq bilok NP 001014431 NP 001014432 NP 005154 NP 001369359 NP 001369360NP 001369361 NP 001369362NP 001159366 NP 001318036 NP 033782Lokus UCSC Hr 14 104 77 104 8 MbHr 12 112 62 112 64 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREA PLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWT TAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEF EYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENR VLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRA RFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY NQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAK EIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITIT PPDQDDSMECVDSERRPHFPQFSYSASGTA A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz serin treoninovih proteyinkinaz bilkiv rozvitku fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz regulyaciya translyaciyi transport vuglevodnij obmin metabolizm glikogenu nejrogenez obmin glyukozi acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami Lokalizovanij u klitinnij membrani citoplazmi yadri membrani Literaturared Jones P F Jakubowicz T Pitossi F J Maurer F Hemmings B A 1991 Molecular cloning and identification of a serine threonine protein kinase of the second messenger subfamily Proc Natl Acad Sci U S A 88 4171 4175 PMID 1851997 DOI 10 1073 pnas 88 10 4171 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Coffer P J Woodgett J R 1991 Molecular cloning and characterisation of a novel putative protein serine kinase related to the cAMP dependent and protein kinase C families Eur J Biochem 201 475 481 PMID 1718748 DOI 10 1111 j 1432 1033 1991 tb16305 x Du K Montminy M 1998 CREB is a regulatory target for the protein kinase Akt PKB J Biol Chem 273 32377 32379 PMID 9829964 DOI 10 1074 jbc 273 49 32377 Rena G Guo S Cichy S C Unterman T G Cohen P 1999 Phosphorylation of the transcription factor forkhead family member FKHR by protein kinase B J Biol Chem 274 17179 17183 PMID 10358075 DOI 10 1074 jbc 274 24 17179 Zimmermann S Moelling K 1999 Phosphorylation and regulation of Raf by Akt protein kinase B Science 286 1741 1744 PMID 10576742 DOI 10 1126 science 286 5445 1741Primitkired Zahvoryuvannya genetichno pov yazani z AKT1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 391 angl Procitovano 11 veresnya 2017 a href wiki D0 A8 D0 B0 D0 B1 D0 BB D0 BE D0 BD Cite web title Shablon Cite web cite web a Obslugovuvannya CS1 Storinki z parametrom url status ale bez parametra archive url posilannya UniProt P31749 angl Arhiv originalu za 25 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhred Hromosoma 14 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title AKT1 amp oldid 43410367