Циклін-залежна кіназа 1 (англ. Cyclin dependent kinase 1) – білок, який кодується геном CDK1, розташованим у людини на короткому плечі 10-ї хромосоми. Довжина поліпептидного ланцюга білка становить 297 амінокислот, а молекулярна маса — 34 095.
CDK1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CDK1, CDC2, CDC28A, P34CDC2, cyclin-dependent kinase 1, cyclin dependent kinase 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 116940 MGI: 88351 HomoloGene: 68203 GeneCards: CDK1 | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
dinaciclib | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 10: 60.78 – 60.79 Mb | Хр. 10: 69.17 – 69.19 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEDYTKIEKI | GEGTYGVVYK | GRHKTTGQVV | AMKKIRLESE | EEGVPSTAIR | ||||
EISLLKELRH | PNIVSLQDVL | MQDSRLYLIF | EFLSMDLKKY | LDSIPPGQYM | ||||
DSSLVKSYLY | QILQGIVFCH | SRRVLHRDLK | PQNLLIDDKG | TIKLADFGLA | ||||
RAFGIPIRVY | THEVVTLWYR | SPEVLLGSAR | YSTPVDIWSI | GTIFAELATK | ||||
KPLFHGDSEI | DQLFRIFRAL | GTPNNEVWPE | VESLQDYKNT | FPKWKPGSLA | ||||
SHVKNLDENG | LDLLSKMLIY | DPAKRISGKM | ALNHPYFNDL | DNQIKKM |
Кодований геном білок за функціями належить до серин/треонінових протеїнкіназ, рецепторів клітини-хазяїна для входу вірусу, рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, клітинний цикл, поділ клітини, мітоз, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті, ядрі, мітохондрії.
Історія дослідження
Працюючи над проблемою регуляції клітинного циклу дріжджів Schizosaccharomyces pombe, британський біолог Пол Нерс виявив ген cdc2, який кодував протеїнкіназу, що виявилася ключовим регулятором клітинного поділу в цих організмів. Наприкінці 1990-х Нерс виявив гомологічний ген і в геномі людини, який назвав CDK1. За відкриття циклін-залежних кіназ його було нагороджено Нобелівською премією з фізіології або медицини 2001 року.
Література
- Lee M.G., Nurse P. (1987). Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2. Nature. 327: 31—35. PMID 3553962 DOI:10.1038/327031a0
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Draetta G., Beach D. (1988). Activation of cdc2 protein kinase during mitosis in human cells: cell cycle-dependent phosphorylation and subunit rearrangement. Cell. 54: 17—26. PMID 3289755 DOI:10.1016/0092-8674(88)90175-4
- Mueller P.R., Coleman T.R., Kumagai A., Dunphy W.G. (1995). Myt1: a membrane-associated inhibitory kinase that phosphorylates Cdc2 on both threonine-14 and tyrosine-15. Science. 270: 86—90. PMID 7569953 DOI:10.1126/science.270.5233.86
- Rosse C., L'Hoste S., Offner N., Picard A., Camonis J. (2003). RLIP, an effector of the Ral GTPases, is a platform for Cdk1 to phosphorylate epsin during the switch off of endocytosis in mitosis. J. Biol. Chem. 278: 30597—30604. PMID 12775724 DOI:10.1074/jbc.M302191200
- Hsu J.-M., Lee Y.-C.G., Yu C.-T.R., Huang C.-Y.F. (2004). Fbx7 functions in the SCF complex regulating Cdk1-cyclin B-phosphorylated hepatoma up-regulated protein (HURP) proteolysis by a proline-rich region. J. Biol. Chem. 279: 32592—32602. PMID 15145941 DOI:10.1074/jbc.M404950200
Примітки
- Сполуки, які фізично взаємодіють з Циклін-залежна кіназа 1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1722 (англ.) . Процитовано 8 вересня 2017.
- UniProt, P06493 (англ.) . Процитовано 8 вересня 2017.
- Benjamin Yang. Three scientists who discovered key elements in cell cycle regulation won Nobel Prize in Medicine. Discovery Medicine, Vol. 1, No. 2, p2, 2001(англ.)
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
Ciklin zalezhna kinaza 1 angl Cyclin dependent kinase 1 bilok yakij koduyetsya genom CDK1 roztashovanim u lyudini na korotkomu plechi 10 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 297 aminokislot a molekulyarna masa 34 095 CDK1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4YC6 4Y72 5HQ0 4YC3IdentifikatoriSimvoliCDK1 CDC2 CDC28A P34CDC2 cyclin dependent kinase 1 cyclin dependent kinase 1Zovnishni ID OMIM 116940 MGI 88351 HomoloGene 68203 GeneCards CDK1Reaguye na spolukudinaciclib Ontologiya genaMolekulyarna funkciya transferase activity nucleotide binding protein kinase activity histone kinase activity kinase activity Hsp70 protein binding GO 0001948 GO 0016582 protein binding RNA polymerase II CTD heptapeptide repeat kinase activity ATP binding protein serine threonine kinase activity chromatin binding cyclin binding cyclin dependent protein kinase activity cyclin dependent protein serine threonine kinase activity virus receptor activityKlitinna komponenta centrosoma membrana vereteno podilu nukleoplazma centr organizaciyi mikrotrubochok midbody spindle microtubule mitohondriya mitotic spindle ekzosoma citoskelet klitinne yadro cyclin dependent protein kinase holoenzyme complex citoplazma gialoplazma mitohondrialnij matriks endoplasmic reticulum membrane cyclin B1 CDK1 complexBiologichnij proces positive regulation of protein localization to nucleus centrosome cycle regulation of embryonic development response to cadmium ion epithelial cell differentiation GO 1904578 response to organic cyclic compound fosforilyuvannya response to copper ion positive regulation of mitotic cell cycle negative regulation of apoptotic process pronuclear fusion response to activity regulation of Schwann cell differentiation podil klitini positive regulation of DNA replication replikaciya DNK mitotic nuclear membrane disassembly GO 1901313 positive regulation of gene expression positive regulation of cardiac muscle cell proliferation chromosome condensation G2 M transition of mitotic cell cycle response to axon injury GO 0035404 peptidyl serine phosphorylation animal organ regeneration response to organonitrogen compound response to amine GO 0100026 Reparaciya DNK klitinnij cikl anaphase promoting complex dependent catabolic process microtubule cytoskeleton organization response to ethanol mitotic G2 DNA damage checkpoint signaling Golgi disassembly peptidyl threonine phosphorylation cell migration ventricular cardiac muscle cell development response to toxic substance response to hydrogen peroxide cellular response to hydrogen peroxide protein localization to kinetochore GO 0097285 apoptoz proliferaciya proteasome mediated ubiquitin dependent protein catabolic process GO 0007067 mitoz DNA damage response signal transduction by p53 class mediator resulting in cell cycle arrest regulyaciya ekspresiyi geniv regulation of meiotic cell cycle ciliary basal body plasma membrane docking protein phosphorylation positive regulation of G2 M transition of mitotic cell cycle protein deubiquitination GO 0007090 mitotic cell cycle phase transition positive regulation of mitochondrial ATP synthesis coupled electron transport viral entry into host cell regulation of G2 M transition of mitotic cell cycle transcription initiation from RNA polymerase II promoter GO 0034622 protein containing complex assembly regulation of mitotic cell cycle phase transition regulation of circadian rhythmDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez983 12534Ensembl ENSG00000170312 ENSMUSG00000019942UniProt P06493 P11440RefSeq mRNK NM 001130829 NM 001170406 NM 001170407 NM 001786 NM 033379NM 001320918NM 007659RefSeq bilok NP 001163877 NP 001163878 NP 001307847 NP 001777 NP 203698NP 031685Lokus UCSC Hr 10 60 78 60 79 MbHr 10 69 17 69 19 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIR EISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYM DSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLA RAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATK KPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLA SHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do serin treoninovih proteyinkinaz receptoriv klitini hazyayina dlya vhodu virusu receptoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz klitinnij cikl podil klitini mitoz acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami Lokalizovanij u citoplazmi citoskeleti yadri mitohondriyi Istoriya doslidzhennyaPracyuyuchi nad problemoyu regulyaciyi klitinnogo ciklu drizhdzhiv Schizosaccharomyces pombe britanskij biolog Pol Ners viyaviv gen cdc2 yakij koduvav proteyinkinazu sho viyavilasya klyuchovim regulyatorom klitinnogo podilu v cih organizmiv Naprikinci 1990 h Ners viyaviv gomologichnij gen i v genomi lyudini yakij nazvav CDK1 Za vidkrittya ciklin zalezhnih kinaz jogo bulo nagorodzheno Nobelivskoyu premiyeyu z fiziologiyi abo medicini 2001 roku LiteraturaLee M G Nurse P 1987 Complementation used to clone a human homologue of the fission yeast cell cycle control gene cdc2 Nature 327 31 35 PMID 3553962 DOI 10 1038 327031a0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Draetta G Beach D 1988 Activation of cdc2 protein kinase during mitosis in human cells cell cycle dependent phosphorylation and subunit rearrangement Cell 54 17 26 PMID 3289755 DOI 10 1016 0092 8674 88 90175 4 Mueller P R Coleman T R Kumagai A Dunphy W G 1995 Myt1 a membrane associated inhibitory kinase that phosphorylates Cdc2 on both threonine 14 and tyrosine 15 Science 270 86 90 PMID 7569953 DOI 10 1126 science 270 5233 86 Rosse C L Hoste S Offner N Picard A Camonis J 2003 RLIP an effector of the Ral GTPases is a platform for Cdk1 to phosphorylate epsin during the switch off of endocytosis in mitosis J Biol Chem 278 30597 30604 PMID 12775724 DOI 10 1074 jbc M302191200 Hsu J M Lee Y C G Yu C T R Huang C Y F 2004 Fbx7 functions in the SCF complex regulating Cdk1 cyclin B phosphorylated hepatoma up regulated protein HURP proteolysis by a proline rich region J Biol Chem 279 32592 32602 PMID 15145941 DOI 10 1074 jbc M404950200PrimitkiSpoluki yaki fizichno vzayemodiyut z Ciklin zalezhna kinaza 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1722 angl Procitovano 8 veresnya 2017 UniProt P06493 angl Procitovano 8 veresnya 2017 Benjamin Yang Three scientists who discovered key elements in cell cycle regulation won Nobel Prize in Medicine Discovery Medicine Vol 1 No 2 p2 2001 angl Div takozhHromosoma 10 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi