Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CCNE1 англ Cyclin E1 білок який кодується однойменним геном розташованим у людей на короткому плечі 19 ї хромосоми Довжи

Циклін E1

Циклін E1

CCNE1 (англ. Cyclin E1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 410 амінокислот, а молекулярна маса — 47 077.

CCNE1
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CCNE1, CCNE, pcyclin E1
Зовнішні ІД OMIM: 123837 MGI: 88316 HomoloGene: 14452 GeneCards: CCNE1
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
898
12447
Ensembl
ENSG00000105173
ENSMUSG00000002068
UniProt
P24864
Q61457
RefSeq (мРНК)
NM_001238
NM_057182
NM_001322259
NM_001322261
NM_001322262
NM_007633
RefSeq (білок)
NP_031659
Локус (UCSC) Хр. 19: 29.81 – 29.82 Mb Хр. 7: 37.8 – 37.81 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKID
RTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPS
RGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLD
WLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAA
KLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWL
NVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFR
GVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSG
KKQSSGPEMA

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, поділ клітини, альтернативний сплайсинг. Локалізований у ядрі.

Література

  • Lew D.J., Dulic V., Reed S.I. (1991). Isolation of three novel human cyclins by rescue of G1 cyclin (Cln) function in yeast. Cell. 66: 1197—1206. PMID 1833066 DOI:10.1016/0092-8674(91)90042-W
  • Ohtsubo M., Theodoras A.M., Schumacher J., Roberts J.M., Pagano M. (1995). Human cyclin E, a nuclear protein essential for the G1-to-S phase transition. Mol. Cell. Biol. 15: 2612—2624. PMID 7739542 DOI:10.1128/MCB.15.5.2612
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Zariwala M., Liu J., Xiong Y. (1998). Cyclin E2, a novel human G1 cyclin and activating partner of CDK2 and CDK3, is induced by viral oncoproteins. Oncogene. 17: 2787—2798. PMID 9840943 DOI:10.1038/sj.onc.1202505
  • Li Y., Mori T., Hata H., Homma Y., Kochi H. (2004). NIRF induces G1 arrest and associates with Cdk2. Biochem. Biophys. Res. Commun. 319: 464—468. PMID 15178429 DOI:10.1016/j.bbrc.2004.04.190
  • Mori T., Ikeda D.D., Fukushima T., Takenoshita S., Kochi H. (2011). NIRF constitutes a nodal point in the cell cycle network and is a candidate tumor suppressor. Cell Cycle. 10: 3284—3299. PMID 21952639 DOI:10.4161/cc.10.19.17176

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1589 (англ.) . Процитовано 12 вересня 2017.
  4. UniProt, P24864 (англ.) . Процитовано 12 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CCNE1 angl Cyclin E1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 410 aminokislot a molekulyarna masa 47 077 CCNE1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1W98IdentifikatoriSimvoliCCNE1 CCNE pcyclin E1Zovnishni ID OMIM 123837 MGI 88316 HomoloGene 14452 GeneCards CCNE1Ontologiya genaMolekulyarna funkciya GO 0001105 transcription coactivator activity kinase activity cyclin dependent protein serine threonine kinase regulator activity GO 0001948 GO 0016582 protein binding androgen receptor binding protein kinase binding cyclin dependent protein serine threonine kinase activity protein kinase activityKlitinna komponenta gialoplazma cyclin dependent protein kinase holoenzyme complex nukleoplazma klitinne yadro cyclin E1 CDK2 complex citoplazma centrosomaBiologichnij proces androgen receptor signaling pathway Wnt signaling pathway regulation of transcription involved in G1 S transition of mitotic cell cycle regulation of cell cycle podil klitini GO 0060469 GO 0009371 positive regulation of transcription DNA templated protein phosphorylation DNA replication initiation klitinnij cikl regulation of protein kinase activity GO 1901227 negative regulation of transcription by RNA polymerase II telomere maintenance homologous chromosome pairing at meiosis GO 0051178 chromosome organization involved in meiotic cell cycle G1 S transition of mitotic cell cycle regulation of cyclin dependent protein serine threonine kinase activity GO 0007067 mitoz regulation of mitotic nuclear division positive regulation of cell population proliferation positive regulation of cell cycle positive regulation of G1 S transition of mitotic cell cycle GO 0007090 mitotic cell cycle phase transitionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez898 12447Ensembl ENSG00000105173 ENSMUSG00000002068UniProt P24864 Q61457RefSeq mRNK NM 001238 NM 057182 NM 001322259 NM 001322261 NM 001322262NM 007633RefSeq bilok NP 001229 NP 001309188 NP 001309190 NP 001309191 NP 001309188 1NP 001309190 1NP 031659Lokus UCSC Hr 19 29 81 29 82 MbHr 7 37 8 37 81 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKID RTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPS RGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLD WLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAA KLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWL NVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFR GVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSG KKQSSGPEMA A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl podil klitini alternativnij splajsing Lokalizovanij u yadri LiteraturaLew D J Dulic V Reed S I 1991 Isolation of three novel human cyclins by rescue of G1 cyclin Cln function in yeast Cell 66 1197 1206 PMID 1833066 DOI 10 1016 0092 8674 91 90042 W Ohtsubo M Theodoras A M Schumacher J Roberts J M Pagano M 1995 Human cyclin E a nuclear protein essential for the G1 to S phase transition Mol Cell Biol 15 2612 2624 PMID 7739542 DOI 10 1128 MCB 15 5 2612 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zariwala M Liu J Xiong Y 1998 Cyclin E2 a novel human G1 cyclin and activating partner of CDK2 and CDK3 is induced by viral oncoproteins Oncogene 17 2787 2798 PMID 9840943 DOI 10 1038 sj onc 1202505 Li Y Mori T Hata H Homma Y Kochi H 2004 NIRF induces G1 arrest and associates with Cdk2 Biochem Biophys Res Commun 319 464 468 PMID 15178429 DOI 10 1016 j bbrc 2004 04 190 Mori T Ikeda D D Fukushima T Takenoshita S Kochi H 2011 NIRF constitutes a nodal point in the cell cycle network and is a candidate tumor suppressor Cell Cycle 10 3284 3299 PMID 21952639 DOI 10 4161 cc 10 19 17176PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1589 angl Procitovano 12 veresnya 2017 UniProt P24864 angl Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ