VDR (англ. Vitamin D receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 427 амінокислот, а молекулярна маса — 48 289.
VDR | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | VDR, NR1I1, PPP1R163, vitamin D (1,25- dihydroxyvitamin D3) receptor, vitamin D receptor | ||||||||||||||||
Зовнішні ІД | OMIM: 601769 MGI: 103076 HomoloGene: 37297 GeneCards: VDR | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
vitamin D-dependent rickets, type 2 | |||||||||||||||||
Реагує на сполуку | |||||||||||||||||
кальцитріол, calcipotriene, doxercalciferol, lithocholic acid, paricalcitol, tacalcitol | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 12: 47.84 – 47.94 Mb | Хр. 15: 97.75 – 97.81 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEAMAASTSL | PDPGDFDRNV | PRICGVCGDR | ATGFHFNAMT | CEGCKGFFRR | ||||
SMKRKALFTC | PFNGDCRITK | DNRRHCQACR | LKRCVDIGMM | KEFILTDEEV | ||||
QRKREMILKR | KEEEALKDSL | RPKLSEEQQR | IIAILLDAHH | KTYDPTYSDF | ||||
CQFRPPVRVN | DGGGSHPSRP | NSRHTPSFSG | DSSSSCSDHC | ITSSDMMDSS | ||||
SFSNLDLSEE | DSDDPSVTLE | LSQLSMLPHL | ADLVSYSIQK | VIGFAKMIPG | ||||
FRDLTSEDQI | VLLKSSAIEV | IMLRSNESFT | MDDMSWTCGN | QDYKYRVSDV | ||||
TKAGHSLELI | EPLIKFQVGL | KKLNLHEEEH | VLLMAICIVS | PDRPGVQDAA | ||||
LIEAIQDRLS | NTLQTYIRCR | HPPPGSHLLY | AKMIQKLADL | RSLNEEHSKQ | ||||
YRCLSFQPEC | SMKLTPLVLE | VFGNEIS |
Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.
Література
- Goto H., Chen K.S., Prahl J.M., Deluca H.F. (1992). A single receptor identical with that from intestine/T47D cells mediates the action of 1,25-dihydroxyvitamin D-3 in HL-60 cells. Biochim. Biophys. Acta. 1132: 103—108. PMID 1324736 DOI:10.1016/0167-4781(92)90063-6
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Mahajan M.A., Samuels H.H. (2000). A new family of nuclear receptor coregulators that integrates nuclear receptor signaling through CBP. Mol. Cell. Biol. 20: 5048—5063. PMID 10866662 DOI:10.1128/MCB.20.14.5048-5063.2000
- Rochel N., Wurtz J.-M., Mitschler A., Klaholz B., Moras D. (2000). The crystal structure of the nuclear receptor for vitamin D bound to its natural ligand. Mol. Cell. 5: 173—179. PMID 10678179 DOI:10.1016/S1097-2765(00)80413-X
- Tocchini-Valentini G., Rochel N., Wurtz J.-M., Mitschler A., Moras D. (2001). Crystal structures of the vitamin D receptor complexed to superagonist 20-epi ligands. Proc. Natl. Acad. Sci. U.S.A. 98: 5491—5496. PMID 11344298 DOI:10.1073/pnas.091018698
- Shaffer P.L., Gewirth D.T. (2002). Structural basis of VDR-DNA interactions on direct repeat response elements. EMBO J. 21: 2242—2252. PMID 11980721 DOI:10.1093/emboj/21.9.2242
Примітки
- Захворювання, генетично пов'язані з VDR переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з VDR переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 19 липня 2017. Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 17 серпня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
VDR angl Vitamin D receptor bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 427 aminokislot a molekulyarna masa 48 289 VDRNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1DB1 1IE8 1IE9 1KB2 1KB4 1KB6 1S0Z 1S19 1TXI 1YNW 2HAM 2HAR 2HAS 2HB7 2HB8 3A2I 3A2J 3A3Z 3A40 3A78 3AUQ 3AUR 3AX8 3AZ1 3AZ2 3AZ3 3B0T 3CS4 3CS6 3KPZ 3M7R 3OGT 3P8X 3TKC 3VHW 4G2I 3W0A 3W0C 3W0Y 3WGP 3WWR 4ITE 4ITF 4PA2 3X31 3X36 4FHH 4FHI 2HBHIdentifikatoriSimvoliVDR NR1I1 PPP1R163 vitamin D 1 25 dihydroxyvitamin D3 receptor vitamin D receptorZovnishni ID OMIM 601769 MGI 103076 HomoloGene 37297 GeneCards VDRPov yazani genetichni zahvoryuvannyavitamin D dependent rickets type 2 Reaguye na spolukukalcitriol calcipotriene doxercalciferol lithocholic acid paricalcitol tacalcitol Ontologiya genaMolekulyarna funkciya lithocholic acid binding sequence specific DNA binding DNA binding lithocholic acid receptor activity GO 0038050 GO 0004886 GO 0038051 nuclear receptor activity steroid hormone receptor activity GO 0001948 GO 0016582 protein binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity zinc ion binding zv yazuvannya z ionom metalu vitamin D response element binding retinoid X receptor binding calcitriol binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific GO 0000975 transcription cis regulatory region binding RNA polymerase II transcription regulatory region sequence specific DNA binding vitamin D binding transcription factor binding nuclear receptor coactivator activity signaling receptor activityKlitinna komponenta klitinne yadro nukleoplazma receptor complex RNA polymerase II transcription regulator complex citoplazmaBiologichnij proces negative regulation of cell population proliferation positive regulation of apoptotic process involved in mammary gland involution positive regulation of keratinocyte differentiation regulation of calcidiol 1 monooxygenase activity intestinal absorption calcium ion transport steroid hormone mediated signaling pathway GO 0009373 regulation of transcription DNA templated laktaciya bile acid signaling pathway animal organ morphogenesis GO 0000767 cell morphogenesis skeletal system development GO 1901313 positive regulation of gene expression GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II multicellular organism development negative regulation of keratinocyte proliferation decidualization GO 1901227 negative regulation of transcription by RNA polymerase II GO 0045996 negative regulation of transcription DNA templated transcription initiation from RNA polymerase II promoter positive regulation of vitamin D 24 hydroxylase activity mammary gland branching involved in pregnancy GO 0072468 signalna transdukciya cellular calcium ion homeostasis transcription DNA templated vitamin D receptor signaling pathway vitamin D metabolic process diferenciaciya klitin intracellular receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7421 22337Ensembl ENSG00000111424 ENSMUSG00000022479UniProt P11473 P48281RefSeq mRNK NM 000376 NM 001017535 NM 001017536 NM 001364085 NM 001374661NM 001374662NM 009504RefSeq bilok NP 000367 NP 001017535 NP 001017536 NP 001351014 NP 001361590NP 001361591NP 033530Lokus UCSC Hr 12 47 84 47 94 MbHr 15 97 75 97 81 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRR SMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEV QRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDF CQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSS SFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPG FRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAA LIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQ YRCLSFQPECSMKLTPLVLEVFGNEIS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do receptoriv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK Lokalizovanij u yadri LiteraturaGoto H Chen K S Prahl J M Deluca H F 1992 A single receptor identical with that from intestine T47D cells mediates the action of 1 25 dihydroxyvitamin D 3 in HL 60 cells Biochim Biophys Acta 1132 103 108 PMID 1324736 DOI 10 1016 0167 4781 92 90063 6 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Mahajan M A Samuels H H 2000 A new family of nuclear receptor coregulators that integrates nuclear receptor signaling through CBP Mol Cell Biol 20 5048 5063 PMID 10866662 DOI 10 1128 MCB 20 14 5048 5063 2000 Rochel N Wurtz J M Mitschler A Klaholz B Moras D 2000 The crystal structure of the nuclear receptor for vitamin D bound to its natural ligand Mol Cell 5 173 179 PMID 10678179 DOI 10 1016 S1097 2765 00 80413 X Tocchini Valentini G Rochel N Wurtz J M Mitschler A Moras D 2001 Crystal structures of the vitamin D receptor complexed to superagonist 20 epi ligands Proc Natl Acad Sci U S A 98 5491 5496 PMID 11344298 DOI 10 1073 pnas 091018698 Shaffer P L Gewirth D T 2002 Structural basis of VDR DNA interactions on direct repeat response elements EMBO J 21 2242 2252 PMID 11980721 DOI 10 1093 emboj 21 9 2242PrimitkiZahvoryuvannya genetichno pov yazani z VDR pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z VDR pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 19 lipnya 2017 Procitovano 11 veresnya 2017 angl Arhiv originalu za 17 serpnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 12 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi