Кофілін-1 (англ. Cofilin 1) – білок, який кодується геном CFL1, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 166 амінокислот, а молекулярна маса — 18 502.
Кофілін-1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CFL1, CFL, HEL-S-15, cofilin, cofilin 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 601442 MGI: 101757 HomoloGene: 99735 GeneCards: CFL1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 65.82 – 65.86 Mb | Хр. 19: 5.54 – 5.55 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MASGVAVSDG | VIKVFNDMKV | RKSSTPEEVK | KRKKAVLFCL | SEDKKNIILE | ||||
EGKEILVGDV | GQTVDDPYAT | FVKMLPDKDC | RYALYDATYE | TKESKKEDLV | ||||
FIFWAPESAP | LKSKMIYASS | KDAIKKKLTG | IKHELQANCY | EEVKDRCTLA | ||||
EKLGGSAVIS | LEGKPL |
Білок має сайт для зв'язування з молекулою актину. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, ядрі, мембрані, клітинних відростках.
Література
- Gillett G.T., Fox M.F., Rowe P.S.N., Casimir C.M., Povey S. (1996). Mapping of human non-muscle type cofilin (CFL1) to chromosome 11q13 and muscle-type cofilin (CFL2) to chromosome 14. Ann. Hum. Genet. 60: 201—211. PMID 8800436 DOI:10.1111/j.1469-1809.1996.tb00423.x
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Davidson M.M., Haslam R.J. (1994). Dephosphorylation of cofilin in stimulated platelets: roles for a GTP-binding protein and Ca2+. Biochem. J. 301: 41—47. PMID 8037689 DOI:10.1042/bj3010041
- Yeoh S., Pope B., Mannherz H.G., Weeds A. (2002). Determining the differences in actin binding by human ADF and cofilin. J. Mol. Biol. 315: 911—925. PMID 11812157 DOI:10.1006/jmbi.2001.5280
- Gohla A., Birkenfeld J., Bokoch G.M. (2005). Chronophin, a novel HAD-type serine protein phosphatase, regulates cofilin-dependent actin dynamics. Nat. Cell Biol. 7: 21—29. PMID 15580268 DOI:10.1038/ncb1201
- Leong W.F., Chow V.T. (2006). Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection. Cell. Microbiol. 8: 565—580. PMID 16548883 DOI:10.1111/j.1462-5822.2005.00644.x
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 14 жовтня 2017. Процитовано 30 січня 2017.
- (англ.) . Архів оригіналу за 26 березня 2017. Процитовано 30 січня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
Kofilin 1 angl Cofilin 1 bilok yakij koduyetsya genom CFL1 roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 166 aminokislot a molekulyarna masa 18 502 Kofilin 1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4BEX 1Q8G 1Q8X 3J0S 5HVK 5L6WIdentifikatoriSimvoliCFL1 CFL HEL S 15 cofilin cofilin 1Zovnishni ID OMIM 601442 MGI 101757 HomoloGene 99735 GeneCards CFL1Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding actin binding actin filament binding signaling receptor bindingKlitinna komponenta citoplazma vezikula cell projection membrana focal adhesion nuclear matrix klitinna membrana vnutrishnoklitinnij ruffle membrane actin cytoskeleton citoskelet lamellipodium membrane ekzosoma klitinne yadro GO 0005578 Pozaklitinna matricya mizhklitinnij prostir cell cell junction cortical actin cytoskeleton gialoplazma lamellipodiumBiologichnij proces response to virus negative regulation of apoptotic process positive regulation by host of viral process cytoskeleton organization Rho protein signal transduction regulation of cell morphogenesis regulation of dendritic spine morphogenesis actin cytoskeleton organization actin filament depolymerization mitotic cytokinesis neural crest cell migration neural fold formation protein phosphorylation actin filament organization establishment of cell polarity actin filament fragmentation positive regulation of actin filament depolymerization response to amino acid interleukin 12 mediated signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1072 12631Ensembl ENSG00000172757 ENSMUSG00000056201UniProt P23528 P18760RefSeq mRNK NM 005507NM 007687RefSeq bilok NP 005498NP 031713Lokus UCSC Hr 11 65 82 65 86 MbHr 19 5 54 5 55 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILE EGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLV FIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLA EKLGGSAVISLEGKPL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Bilok maye sajt dlya zv yazuvannya z molekuloyu aktinu Lokalizovanij u klitinnij membrani citoplazmi citoskeleti yadri membrani klitinnih vidrostkah LiteraturaGillett G T Fox M F Rowe P S N Casimir C M Povey S 1996 Mapping of human non muscle type cofilin CFL1 to chromosome 11q13 and muscle type cofilin CFL2 to chromosome 14 Ann Hum Genet 60 201 211 PMID 8800436 DOI 10 1111 j 1469 1809 1996 tb00423 x The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Davidson M M Haslam R J 1994 Dephosphorylation of cofilin in stimulated platelets roles for a GTP binding protein and Ca2 Biochem J 301 41 47 PMID 8037689 DOI 10 1042 bj3010041 Yeoh S Pope B Mannherz H G Weeds A 2002 Determining the differences in actin binding by human ADF and cofilin J Mol Biol 315 911 925 PMID 11812157 DOI 10 1006 jmbi 2001 5280 Gohla A Birkenfeld J Bokoch G M 2005 Chronophin a novel HAD type serine protein phosphatase regulates cofilin dependent actin dynamics Nat Cell Biol 7 21 29 PMID 15580268 DOI 10 1038 ncb1201 Leong W F Chow V T 2006 Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection Cell Microbiol 8 565 580 PMID 16548883 DOI 10 1111 j 1462 5822 2005 00644 xPrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 14 zhovtnya 2017 Procitovano 30 sichnya 2017 angl Arhiv originalu za 26 bereznya 2017 Procitovano 30 sichnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi