ELANE (англ. Elastase, neutrophil expressed) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 267 амінокислот, а молекулярна маса — 28 518.
ELANE | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | ELANE, ELA2, GE, HLE, HNE, NE, PMN-E, SCN1, elastase, neutrophil expressed | ||||||||||||||||
Зовнішні ІД | OMIM: 130130 MGI: 2679229 HomoloGene: 20455 GeneCards: ELANE | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
cyclic hematopoiesis, Нейтропенія | |||||||||||||||||
Реагує на сполуку | |||||||||||||||||
sivelestat, alvelestat | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 0.85 – 0.86 Mb | Хр. 10: 79.72 – 79.72 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MTLGRRLACL | FLACVLPALL | LGGTALASEI | VGGRRARPHA | WPFMVSLQLR | ||||
GGHFCGATLI | APNFVMSAAH | CVANVNVRAV | RVVLGAHNLS | RREPTRQVFA | ||||
VQRIFENGYD | PVNLLNDIVI | LQLNGSATIN | ANVQVAQLPA | QGRRLGNGVQ | ||||
CLAMGWGLLG | RNRGIASVLQ | ELNVTVVTSL | CRRSNVCTLV | RGRQAGVCFG | ||||
DSGSPLVCNG | LIHGIASFVR | GGCASGLYPD | AFAPVAQFVN | WIDSIIQRSE | ||||
DNPCPHPRDP | DPASRTH |
Кодований геном білок за функціями належить до гідролаз, протеаз, серинових протеаз.
Література
- Nakamura H., Okano K., Aoki Y., Shimizu H., Naruto M. (1987). Nucleotide sequence of human bone marrow serine protease (medullasin) gene. Nucleic Acids Res. 15: 9601—9601. PMID 3479752 DOI:10.1093/nar/15.22.9601
- Okano K., Aoki Y., Shimizu H., Naruto M. (1990). Functional expression of human leukocyte elastase (HLE)/medullasin in eukaryotic cells. Biochem. Biophys. Res. Commun. 167: 1326—1332. PMID 2322278 DOI:10.1016/0006-291X(90)90668-D
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Gaskin G., Kendal H., Coulthart A., Turner N., Pusey C.D. (1995). Use of proteinase 3 purified by reverse phase HPLC to detect autoantibodies in systemic vasculitis. J. Immunol. Methods. 180: 25—33. PMID 7897245 DOI:10.1016/0022-1759(94)00295-8
- Aoki Y., Hase T. (1991). The primary structure and elastinolytic activity of medullasin (a serine protease of bone marrow). Biochem. Biophys. Res. Commun. 178: 501—506. PMID 1859409 DOI:10.1016/0006-291X(91)90135-T
- Tralau T., Meyer-Hoffert U., Schroder J.M., Wiedow O. (2004). Human leukocyte elastase and cathepsin G are specific inhibitors of C5a-dependent neutrophil enzyme release and chemotaxis. Exp. Dermatol. 13: 316—325. PMID 15140022 DOI:10.1111/j.0906-6705.2004.00145.x
Примітки
- Захворювання, генетично пов'язані з ELANE переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з Elastase, neutrophil expressed переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 13 березня 2016. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
ELANE angl Elastase neutrophil expressed bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 267 aminokislot a molekulyarna masa 28 518 ELANENayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1B0F 1H1B 1HNE 1PPF 1PPG 2RG3 2Z7F 3Q76 3Q77 4NZL 4WVP 5A09 5A0A 5A0B 5A0C 5ABWIdentifikatoriSimvoliELANE ELA2 GE HLE HNE NE PMN E SCN1 elastase neutrophil expressedZovnishni ID OMIM 130130 MGI 2679229 HomoloGene 20455 GeneCards ELANEPov yazani genetichni zahvoryuvannyacyclic hematopoiesis Nejtropeniya Reaguye na spolukusivelestat alvelestat Ontologiya genaMolekulyarna funkciya GO 0001106 transcription corepressor activity heparin binding endopeptidase activity protease binding GO 0070122 peptidase activity GO 0001948 GO 0016582 protein binding serine type peptidase activity hydrolase activity GO 0019974 cytokine binding serine type endopeptidase activityKlitinna komponenta citoplazma transcription repressor complex secretory granule extracellular region cell surface ekzosoma mizhklitinnij prostir azurophil granule lumen specific granule lumen collagen containing extracellular matrixBiologichnij proces response to yeast positive regulation of MAP kinase activity negative regulation of chemotaxis cellular calcium ion homeostasis extracellular matrix disassembly acute inflammatory response to antigenic stimulus GO 1901227 negative regulation of transcription by RNA polymerase II defense response to fungus proteoliz response to lipopolysaccharide positive regulation of immune response GO 0044257 protein catabolic process defense response to bacterium Fagocitoz neutrophil mediated killing of fungus negative regulation of inflammatory response response to UV leukocyte migration positive regulation of smooth muscle cell proliferation leukocyte migration involved in inflammatory response positive regulation of leukocyte tethering or rolling antimicrobial humoral response neutrophil degranulationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1991 50701Ensembl ENSG00000277571 ENSG00000197561 ENSMUSG00000020125UniProt P08246 Q3UP87RefSeq mRNK NM 001972NM 015779RefSeq bilok NP 001963NP 056594Lokus UCSC Hr 19 0 85 0 86 MbHr 10 79 72 79 72 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLR GGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFA VQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQ CLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFG DSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSE DNPCPHPRDPDPASRTH A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz proteaz serinovih proteaz LiteraturaNakamura H Okano K Aoki Y Shimizu H Naruto M 1987 Nucleotide sequence of human bone marrow serine protease medullasin gene Nucleic Acids Res 15 9601 9601 PMID 3479752 DOI 10 1093 nar 15 22 9601 Okano K Aoki Y Shimizu H Naruto M 1990 Functional expression of human leukocyte elastase HLE medullasin in eukaryotic cells Biochem Biophys Res Commun 167 1326 1332 PMID 2322278 DOI 10 1016 0006 291X 90 90668 D The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Gaskin G Kendal H Coulthart A Turner N Pusey C D 1995 Use of proteinase 3 purified by reverse phase HPLC to detect autoantibodies in systemic vasculitis J Immunol Methods 180 25 33 PMID 7897245 DOI 10 1016 0022 1759 94 00295 8 Aoki Y Hase T 1991 The primary structure and elastinolytic activity of medullasin a serine protease of bone marrow Biochem Biophys Res Commun 178 501 506 PMID 1859409 DOI 10 1016 0006 291X 91 90135 T Tralau T Meyer Hoffert U Schroder J M Wiedow O 2004 Human leukocyte elastase and cathepsin G are specific inhibitors of C5a dependent neutrophil enzyme release and chemotaxis Exp Dermatol 13 316 325 PMID 15140022 DOI 10 1111 j 0906 6705 2004 00145 xPrimitkiZahvoryuvannya genetichno pov yazani z ELANE pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Elastase neutrophil expressed pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 13 bereznya 2016 Procitovano 12 veresnya 2017 angl Arhiv originalu za 17 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi