GH1 (англ. Growth hormone 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 217 амінокислот, а молекулярна маса — 24 847.
GH1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | GH1, GH, GH-N, GHN, IGHD1B, hGH-N, GHB5, Growth hormone 1, IGHD2, IGHD1A | ||||||||||||||||
Зовнішні ІД | OMIM: 139250 MGI: 95707 HomoloGene: 128036 GeneCards: GH1 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
isolated growth hormone deficiency | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 17: 63.92 – 63.92 Mb | Хр. 11: 106.19 – 106.19 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MATGSRTSLL | LAFGLLCLPW | LQEGSAFPTI | PLSRLFDNAM | LRAHRLHQLA | ||||
FDTYQEFEEA | YIPKEQKYSF | LQNPQTSLCF | SESIPTPSNR | EETQQKSNLE | ||||
LLRISLLLIQ | SWLEPVQFLR | SVFANSLVYG | ASDSNVYDLL | KDLEEGIQTL | ||||
MGRLEDGSPR | TGQIFKQTYS | KFDTNSHNDD | ALLKNYGLLY | CFRKDMDKVE | ||||
TFLRIVQCRS | VEGSCGF |
Кодований геном білок за функціями належить до гормонів, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Секретований назовні.
Література
- Roskam W., Rougeon F. (1979). Molecular cloning and nucleotide sequence of the human growth hormone structural gene. Nucleic Acids Res. 7: 305—320. PMID 386281 DOI:10.1093/nar/7.2.305
- Martial J.A., Hallewell R.A., Baxter J.D., Goodman H.M. (1979). Human growth hormone: complementary DNA cloning and expression in bacteria. Science. 205: 602—607. PMID 377496 DOI:10.1126/science.377496
- Denoto F.M., Moore D.D., Goodman H.M. (1981). Human growth hormone DNA sequence and mRNA structure: possible alternative splicing. Nucleic Acids Res. 9: 3719—3730. PMID 6269091 DOI:10.1093/nar/9.15.3719
- Seeburg P.H. (1982). The human growth hormone gene family: nucleotide sequences show recent divergence and predict a new polypeptide hormone. DNA. 1: 239—249. PMID 7169009 DOI:10.1089/dna.1.1982.1.239
- Sedman L., Padhukasahasram B., Kelgo P., Laan M. (2008). Complex signatures of locus-specific selective pressures and gene conversion on human growth hormone/chorionic somatomammotropin genes. Hum. Mutat. 29: 1181—1193. PMID 18473352 DOI:10.1002/humu.20767
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
Примітки
- Захворювання, генетично пов'язані з GH1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 25 березня 2016. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
GH1 angl Growth hormone 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 217 aminokislot a molekulyarna masa 24 847 GH1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1AXI 1HUW 1A22 1HGU 3HHR 1KF9 1HWG 1BP3 1HWHIdentifikatoriSimvoliGH1 GH GH N GHN IGHD1B hGH N GHB5 Growth hormone 1 IGHD2 IGHD1AZovnishni ID OMIM 139250 MGI 95707 HomoloGene 128036 GeneCards GH1Pov yazani genetichni zahvoryuvannyaisolated growth hormone deficiency Ontologiya genaMolekulyarna funkciya hormone activity zv yazuvannya z ionom metalu GO 0001948 GO 0016582 protein binding growth factor activity growth hormone receptor binding prolactin receptor bindingKlitinna komponenta extracellular region mizhklitinnij prostir endosome lumen growth hormone receptor complex collagen containing extracellular matrixBiologichnij proces growth hormone receptor signaling pathway via JAK STAT response to estradiol positive regulation of MAP kinase activity positive regulation of receptor internalization bone maturation growth hormone receptor signaling pathway positive regulation of insulin like growth factor receptor signaling pathway positive regulation of multicellular organism growth positive regulation of peptidyl tyrosine phosphorylation positive regulation of phosphatidylinositol 3 kinase signaling positive regulation of receptor signaling pathway via JAK STAT positive regulation of activation of Janus kinase activity positive regulation of tyrosine phosphorylation of STAT protein regulation of signaling receptor activity positive regulation of glucose transmembrane transport response to nutrient levels positive regulation of growth animal organ development GO 0072468 signalna transdukciyaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2688 14599Ensembl ENSG00000259384 ENSMUSG00000020713UniProt P01241 P06880RefSeq mRNK NM 000515 NM 022559 NM 022560 NM 022561 NM 022562NM 008117RefSeq bilok NP 000506 NP 072053 NP 072054NP 032143Lokus UCSC Hr 17 63 92 63 92 MbHr 11 106 19 106 19 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLA FDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLE LLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTL MGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVE TFLRIVQCRSVEGSCGF A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gormoniv fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku Sekretovanij nazovni LiteraturaRoskam W Rougeon F 1979 Molecular cloning and nucleotide sequence of the human growth hormone structural gene Nucleic Acids Res 7 305 320 PMID 386281 DOI 10 1093 nar 7 2 305 Martial J A Hallewell R A Baxter J D Goodman H M 1979 Human growth hormone complementary DNA cloning and expression in bacteria Science 205 602 607 PMID 377496 DOI 10 1126 science 377496 Denoto F M Moore D D Goodman H M 1981 Human growth hormone DNA sequence and mRNA structure possible alternative splicing Nucleic Acids Res 9 3719 3730 PMID 6269091 DOI 10 1093 nar 9 15 3719 Seeburg P H 1982 The human growth hormone gene family nucleotide sequences show recent divergence and predict a new polypeptide hormone DNA 1 239 249 PMID 7169009 DOI 10 1089 dna 1 1982 1 239 Sedman L Padhukasahasram B Kelgo P Laan M 2008 Complex signatures of locus specific selective pressures and gene conversion on human growth hormone chorionic somatomammotropin genes Hum Mutat 29 1181 1193 PMID 18473352 DOI 10 1002 humu 20767 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504PrimitkiZahvoryuvannya genetichno pov yazani z GH1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 25 bereznya 2016 Procitovano 12 veresnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 17 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi