Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

Інсуліноподібний фактор росту 1 ІФР 1 англ Insulin like growth factor 1 IGF 1 або соматомедін C білок який кодується ген

Інсуліноподібний фактор росту 1

Інсуліноподібний фактор росту 1

Інсуліноподібний фактор росту 1 (ІФР-1, англ. Insulin like growth factor, 1 IGF-1) або соматомедін C – білок, який кодується геном IGF1, розташованим у людини на довгому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 195 амінокислот, а молекулярна маса — 21 841. Поліпептидний гормон та фактор росту, подібний за структурою до інсуліну. Він здійснює ендокринну, і регуляцію процесів росту і розвитку і грає важливу роль в рості дитини та має анаболічний ефект в дорослих.

Інсуліноподібний фактор росту 1
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IGF1, IGF-I, IGF1A, IGFI, MGF, insulin like growth factor 1, IGF
Зовнішні ІД OMIM: 147440 HomoloGene: 515 GeneCards: IGF1
Пов'язані генетичні захворювання
growth delay due to insulin-like growth factor type 1 deficiency
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
3479
24482
Ensembl
ENSG00000017427
ENSRNOG00000004517
UniProt
P05019
P08025
RefSeq (мРНК)
NM_000618
NM_001111283
NM_001111284
NM_001111285
NM_001082477
NM_001082478
NM_001082479
NM_178866
RefSeq (білок)
NP_000609
NP_001104753
NP_001104754
NP_001104755
NP_001075946
NP_001075947
NP_001075948
NP_849197
Локус (UCSC) Хр. 12: 102.4 – 102.48 Mb н/д
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Цей ген є висококонсервативним у різних видів ссавців, зокрема й у ділянці промотору та інших регуляторних послідовностей, що свідчить про наявність шляхів регуляції із залученням ІФР-1 у предків сучасних ссавців.

В ембріонів бика ІФР-1 синтезується, починаючи з ранніх етапів дроблення, на стадії бластоцисти та гаструляції.

Див. також

Примітки

  1. Захворювання, генетично пов'язані з Інсуліноподібний фактор росту 1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 26 січня 2018. Процитовано 12 січня 2018.
  5. (англ.) . Архів оригіналу за 13 січня 2018. Процитовано 12 січня 2018.
  6. Melmed, S; Polonsky, KS; Larsen, PR; Kronenberg, HM (2011). Williams Textbook of Endocrinology (вид. 11th). Saunders. с. 478–479. ISBN .
  7. Rotwein P. (2017). Diversification of the insulin-like growth factor 1 gene in mammals. PloS one, 12(12), e0189642. https://doi.org/10.1371/journal.pone.0189642
  8. Yaseen, M., Wrenzycki, C., Herrmann, D., Carnwath, J., & Niemann, H. (2001). Changes in the relative abundance of mRNA transcripts for insulin-like growth factor (IGF-I and IGF-II) ligands and their receptors (IGF-IR/IGF-IIR) in preimplantation bovine embryos derived from different in vitro systems. Reproduction, 122(4), 601-610. Retrieved Jan 22, 2024, from https://doi.org/10.1530/rep.0.1220601

Література

  • le Bouc Y., Dreyer D., Jaeger F., Binoux M., Sondermeyer P. (1986). Complete characterization of the human IGF-I nucleotide sequence isolated from a newly constructed adult liver cDNA library. FEBS Lett. 196: 108—112. PMID 2935423 DOI:10.1016/0014-5793(86)80223-X
  • Rotwein P. (1986). Two insulin-like growth factor I messenger RNAs are expressed in human liver. Proc. Natl. Acad. Sci. U.S.A. 83: 77—81. PMID 3455760 DOI:10.1073/pnas.83.1.77
  • Tobin G., Yee D., Brunner N., Rotwein P. (1990). A novel human insulin-like growth factor I messenger RNA is expressed in normal and tumor cells. Mol. Endocrinol. 4: 1914—1920. PMID 2082190 DOI:10.1210/mend-4-12-1914
  • Steenbergh P.H., Koonen-Reemst A.M.C.B., Cleutjens C.B.J.M., Sussenbach J.S. (1991). Complete nucleotide sequence of the high molecular weight human IGF-I mRNA. Biochem. Biophys. Res. Commun. 175: 507—514. PMID 2018498 DOI:10.1016/0006-291X(91)91593-2
  • Sandberg-Nordqvist A.-C., Staehlbom P.-A., Lake M., Sara V.R. (1992). Characterization of two cDNAs encoding insulin-like growth factor 1 (IGF-1) in the human fetal brain. Brain Res. Mol. Brain Res. 12: 275—277. PMID 1372070 DOI:10.1016/0169-328X(92)90094-R
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.
image Це незавершена стаття з фізіології тварин.
Ви можете проєкту, виправивши або дописавши її.


Послідовність амінокислот
1020304050
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGP
ETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSC
DLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRK
GWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

Insulinopodibnij faktor rostu 1 IFR 1 angl Insulin like growth factor 1 IGF 1 abo somatomedin C bilok yakij koduyetsya genom IGF1 roztashovanim u lyudini na dovgomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 195 aminokislot a molekulyarna masa 21 841 Polipeptidnij gormon ta faktor rostu podibnij za strukturoyu do insulinu Vin zdijsnyuye endokrinnu i regulyaciyu procesiv rostu i rozvitku i graye vazhlivu rol v rosti ditini ta maye anabolichnij efekt v doroslih Insulinopodibnij faktor rostu 1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1B9G 1GZR 1GZY 1GZZ 1H02 1H59 1IMX 1PMX 1TGR 1WQJ 2DSR 2GF1 3GF1 3LRI 1BQT 4XSSIdentifikatoriSimvoliIGF1 IGF I IGF1A IGFI MGF insulin like growth factor 1 IGFZovnishni ID OMIM 147440 HomoloGene 515 GeneCards IGF1Pov yazani genetichni zahvoryuvannyagrowth delay due to insulin like growth factor type 1 deficiencyOntologiya genaMolekulyarna funkciya hormone activity insulin receptor binding growth factor activity integrin binding GO 0001948 GO 0016582 protein binding insulin like growth factor receptor bindingKlitinna komponenta extracellular region exocytic vesicle insulin like growth factor binding protein complex platelet alpha granule lumen insulin like growth factor ternary complex alphav beta3 integrin IGF 1 IGF1R complex klitinna membrana mizhklitinnij prostirBiologichnij proces positive regulation of transcription regulatory region DNA binding skeletal system development positive regulation of glucose import muscle organ development positive regulation of Ras protein signal transduction response to heat positive regulation of cardiac muscle hypertrophy positive regulation of smooth muscle cell migration replikaciya DNK positive regulation of insulin like growth factor receptor signaling pathway phosphatidylinositol 3 kinase signaling positive regulation of DNA binding Ras protein signal transduction proliferaciya positive regulation of mitotic nuclear division positive regulation of trophectodermal cell proliferation positive regulation of glycogen biosynthetic process positive regulation of fibroblast proliferation ERK1 and ERK2 cascade negative regulation of extrinsic apoptotic signaling pathway cell activation negative regulation of oocyte development GO 0060469 GO 0009371 positive regulation of transcription DNA templated bone mineralization involved in bone maturation positive regulation of peptidyl tyrosine phosphorylation positive regulation of MAPK cascade proteoglycan biosynthetic process positive regulation of activated T cell proliferation positive regulation of epithelial cell proliferation negative regulation of release of cytochrome c from mitochondria protein stabilization myotube cell development positive regulation of DNA replication myoblast proliferation skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration positive regulation of protein secretion positive regulation of glycoprotein biosynthetic process regulyaciya ekspresiyi geniv phosphatidylinositol mediated signaling positive regulation of smooth muscle cell proliferation muscle hypertrophy protein kinase B signaling regulation of multicellular organism growth positive regulation of cell migration platelet degranulation positive regulation of calcineurin NFAT signaling cascade positive regulation of phosphatidylinositol 3 kinase signaling myoblast differentiation glycolate metabolic process positive regulation of glycolytic process negative regulation of smooth muscle cell apoptotic process GO 0072468 signalna transdukciya GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of cell growth involved in cardiac muscle cell development positive regulation of cell population proliferation positive regulation of osteoblast differentiation activation of protein kinase B activity insulin like growth factor receptor signaling pathway negative regulation of apoptotic process positive regulation of tyrosine phosphorylation of STAT protein regulation of signaling receptor activity GO 1901313 positive regulation of gene expression negative regulation of gene expression cellular response to amyloid beta positive regulation of vascular associated smooth muscle cell proliferation negative regulation of vascular associated smooth muscle cell apoptotic process negative regulation of interleukin 1 beta production negative regulation of tumor necrosis factor production negative regulation of neuroinflammatory response negative regulation of amyloid beta formationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3479 24482Ensembl ENSG00000017427 ENSRNOG00000004517UniProt P05019 P08025RefSeq mRNK NM 000618 NM 001111283 NM 001111284 NM 001111285NM 001082477 NM 001082478 NM 001082479 NM 178866RefSeq bilok NP 000609 NP 001104753 NP 001104754 NP 001104755NP 001075946 NP 001075947 NP 001075948 NP 849197Lokus UCSC Hr 12 102 4 102 48 Mbn dPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Cej gen ye visokokonservativnim u riznih vidiv ssavciv zokrema j u dilyanci promotoru ta inshih regulyatornih poslidovnostej sho svidchit pro nayavnist shlyahiv regulyaciyi iz zaluchennyam IFR 1 u predkiv suchasnih ssavciv V embrioniv bika IFR 1 sintezuyetsya pochinayuchi z rannih etapiv droblennya na stadiyi blastocisti ta gastrulyaciyi Div takozhHromosoma 12PrimitkiZahvoryuvannya genetichno pov yazani z Insulinopodibnij faktor rostu 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 26 sichnya 2018 Procitovano 12 sichnya 2018 angl Arhiv originalu za 13 sichnya 2018 Procitovano 12 sichnya 2018 Melmed S Polonsky KS Larsen PR Kronenberg HM 2011 Williams Textbook of Endocrinology vid 11th Saunders s 478 479 ISBN 978 1416029113 Rotwein P 2017 Diversification of the insulin like growth factor 1 gene in mammals PloS one 12 12 e0189642 https doi org 10 1371 journal pone 0189642 Yaseen M Wrenzycki C Herrmann D Carnwath J amp Niemann H 2001 Changes in the relative abundance of mRNA transcripts for insulin like growth factor IGF I and IGF II ligands and their receptors IGF IR IGF IIR in preimplantation bovine embryos derived from different in vitro systems Reproduction 122 4 601 610 Retrieved Jan 22 2024 from https doi org 10 1530 rep 0 1220601Literaturale Bouc Y Dreyer D Jaeger F Binoux M Sondermeyer P 1986 Complete characterization of the human IGF I nucleotide sequence isolated from a newly constructed adult liver cDNA library FEBS Lett 196 108 112 PMID 2935423 DOI 10 1016 0014 5793 86 80223 X Rotwein P 1986 Two insulin like growth factor I messenger RNAs are expressed in human liver Proc Natl Acad Sci U S A 83 77 81 PMID 3455760 DOI 10 1073 pnas 83 1 77 Tobin G Yee D Brunner N Rotwein P 1990 A novel human insulin like growth factor I messenger RNA is expressed in normal and tumor cells Mol Endocrinol 4 1914 1920 PMID 2082190 DOI 10 1210 mend 4 12 1914 Steenbergh P H Koonen Reemst A M C B Cleutjens C B J M Sussenbach J S 1991 Complete nucleotide sequence of the high molecular weight human IGF I mRNA Biochem Biophys Res Commun 175 507 514 PMID 2018498 DOI 10 1016 0006 291X 91 91593 2 Sandberg Nordqvist A C Staehlbom P A Lake M Sara V R 1992 Characterization of two cDNAs encoding insulin like growth factor 1 IGF 1 in the human fetal brain Brain Res Mol Brain Res 12 275 277 PMID 1372070 DOI 10 1016 0169 328X 92 90094 R The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Ce nezavershena stattya z fiziologiyi tvarin Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Poslidovnist aminokislot1020304050MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGKA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin

Дата публікації:
Топ