PRM2 (англ. Protamine 2) – білок-протамін, який кодується однойменним геном, розташованим у людей на 16-й хромосомі. Довжина поліпептидного ланцюга білка становить 102 амінокислот, а молекулярна маса — 13 051.
PRM2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | PRM2, CT94.2, protamine 2 | ||||||||||||||||
Зовнішні ІД | OMIM: 182890 MGI: 97766 GeneCards: PRM2 | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 16: 11.28 – 11.28 Mb | Хр. 16: 10.61 – 10.61 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
Кодований геном білок за функціями належить до , фосфопротеїнів. Задіяний у таких біологічних процесах, як диференціація клітин, сперматогенез, конденсація ДНК, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.
Література
- Domenjoud L., Fronia C., Uhde F., Engel W. (1988). Sequence of human protamine 2 cDNA. Nucleic Acids Res. 16: 7733—7733. PMID 3412906 DOI:10.1093/nar/16.15.7733
- Domenjoud L., Nussbaum G., Adham I.M., Greeske G., Engel W. (1990). Genomic sequences of human protamines whose genes, PRM1 and PRM2, are clustered. Genomics. 8: 127—133. PMID 2081589 DOI:10.1016/0888-7543(90)90234-L
- Wyckoff G.J., Wang W., Wu C.-I. (2000). Rapid evolution of male reproductive genes in the descent of man. Nature. 403: 304—309. PMID 10659848 DOI:10.1038/35002070
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Martinage A., Arkhis A., Alimi E., Sautiere P., Chevaillier P. (1990). Molecular characterization of nuclear basic protein HPI1, a putative precursor of human sperm protamines HP2 and HP3. Eur. J. Biochem. 191: 449—451. PMID 2384091 DOI:10.1111/j.1432-1033.1990.tb19142.x
- McKay D.J., Renaux B.S., Dixon G.H. (1986). Human sperm protamines. Amino-acid sequences of two forms of protamine P2. Eur. J. Biochem. 156: 5—8. PMID 3956509 DOI:10.1111/j.1432-1033.1986.tb09540.x
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:9448 (англ.) . Процитовано 21 вересня 2017.
- (англ.) . Архів оригіналу за 28 квітня 2017. Процитовано 21 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
PRM2 angl Protamine 2 bilok protamin yakij koduyetsya odnojmennim genom roztashovanim u lyudej na 16 j hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 102 aminokislot a molekulyarna masa 13 051 PRM2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2AWRIdentifikatoriSimvoliPRM2 CT94 2 protamine 2Zovnishni ID OMIM 182890 MGI 97766 GeneCards PRM2Ontologiya genaMolekulyarna funkciya DNA binding zinc ion binding cadmium ion bindingKlitinna komponenta Nukleosoma klitinne yadro nukleoplazma hromosomaBiologichnij proces multicellular organism development diferenciaciya klitin chromosome condensation nucleus organization spermatid development SpermatogenezDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez5620 19119Ensembl ENSG00000122304 ENSMUSG00000038015UniProt P04554 P07978RefSeq mRNK NM 001286356 NM 001286357 NM 001286358 NM 001286359 NM 002762NM 008933RefSeq bilok NP 001273285 NP 001273286 NP 001273287 NP 001273288 NP 002753NP 032959Lokus UCSC Hr 16 11 28 11 28 MbHr 16 10 61 10 61 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQ SHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCR RH C Cisteyin E Glutaminova kislota G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak diferenciaciya klitin spermatogenez kondensaciya DNK alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri hromosomah LiteraturaDomenjoud L Fronia C Uhde F Engel W 1988 Sequence of human protamine 2 cDNA Nucleic Acids Res 16 7733 7733 PMID 3412906 DOI 10 1093 nar 16 15 7733 Domenjoud L Nussbaum G Adham I M Greeske G Engel W 1990 Genomic sequences of human protamines whose genes PRM1 and PRM2 are clustered Genomics 8 127 133 PMID 2081589 DOI 10 1016 0888 7543 90 90234 L Wyckoff G J Wang W Wu C I 2000 Rapid evolution of male reproductive genes in the descent of man Nature 403 304 309 PMID 10659848 DOI 10 1038 35002070 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Martinage A Arkhis A Alimi E Sautiere P Chevaillier P 1990 Molecular characterization of nuclear basic protein HPI1 a putative precursor of human sperm protamines HP2 and HP3 Eur J Biochem 191 449 451 PMID 2384091 DOI 10 1111 j 1432 1033 1990 tb19142 x McKay D J Renaux B S Dixon G H 1986 Human sperm protamines Amino acid sequences of two forms of protamine P2 Eur J Biochem 156 5 8 PMID 3956509 DOI 10 1111 j 1432 1033 1986 tb09540 xPrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9448 angl Procitovano 21 veresnya 2017 angl Arhiv originalu za 28 kvitnya 2017 Procitovano 21 veresnya 2017 Div takozhHromosoma 16 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi