Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

HFE англ Hemochromatosis білок який кодується однойменним геном розташованим у людей на короткому плечі 6 ї хромосоми До

HFE

HFE

HFE (англ. Hemochromatosis) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 348 амінокислот, а молекулярна маса — 40 108.

HFE
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HFE, HFE1, HH, HLA-H, MVCD7, TFQTL2, HFE gene, hemochromatosis, homeostatic iron regulator
Зовнішні ІД OMIM: 613609 HomoloGene: 88330 GeneCards: HFE
Пов'язані генетичні захворювання
серцево-судинні захворювання, артеріальна гіпертензія, variegate porphyria, hemochromatosis type 1
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
3077
29199
Ensembl
ENSG00000010704
ENSRNOG00000016967
UniProt
Q30201
O35799
RefSeq (мРНК)
NM_001173434
NM_001173435
NM_053301
RefSeq (білок)
NP_001166905
NP_001166906
NP_445753
Локус (UCSC) Хр. 6: 26.09 – 26.1 Mb н/д
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEAL
GYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTV
DFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP
DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRG
VLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKE
FEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE

Задіяний у таких біологічних процесах, як транспорт іонів, транспорт заліза, транспорт, альтернативний сплайсинг. Білок має сайт для зв'язування з іоном заліза. Локалізований у клітинній мембрані, мембрані.

Література

  • Albig W., Drabent B., Burmester N., Bode C., Doenecke D. (1998). The haemochromatosis candidate gene HFE (HLA-H) of man and mouse is located in syntenic regions within the histone gene. J. Cell. Biochem. 69: 117—126. PMID 9548560 DOI:10.1002/(SICI)1097-4644(19980501)69:2<117::AID-JCB3>3.0.CO;2-V
  • Rhodes D.A., Trowsdale J. (1999). Alternate splice variants of the hemochromatosis gene Hfe. Immunogenetics. 49: 357—359. PMID 10079302 DOI:10.1007/s002510050505
  • Sanchez M., Bruguera M., Rodos J., Oliva R. (2001). Complete characterization of the 3' region of the human and mouse hereditary hemochromatosis HFE gene and detection of novel splicing forms. Blood Cells Mol. Dis. 27: 35—43. PMID 11358357 DOI:10.1006/bcmd.2000.0346
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Bennett M.J., Lebron J.A., Bjorkman P.J. (2000). Crystal structure of the hereditary haemochromatosis protein HFE complexed with transferrin receptor. Nature. 403: 46—53. PMID 10638746 DOI:10.1038/47417
  • Hillman R.T., Green R.E., Brenner S.E. (2004). An unappreciated role for RNA surveillance. Genome Biol. 5: R8.1—R8.16. PMID 14759258 DOI:10.1186/gb-2004-5-2-r8

Примітки

  1. Захворювання, генетично пов'язані з HFE переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:4886 (англ.) . Процитовано 6 вересня 2017.
  5. (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 6 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

HFE angl Hemochromatosis bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 348 aminokislot a molekulyarna masa 40 108 HFENayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1DE4 1A6ZIdentifikatoriSimvoliHFE HFE1 HH HLA H MVCD7 TFQTL2 HFE gene hemochromatosis homeostatic iron regulatorZovnishni ID OMIM 613609 HomoloGene 88330 GeneCards HFEPov yazani genetichni zahvoryuvannyasercevo sudinni zahvoryuvannya arterialna gipertenziya variegate porphyria hemochromatosis type 1 Ontologiya genaMolekulyarna funkciya peptide antigen binding beta 2 microglobulin binding co receptor binding GO 0001948 GO 0016582 protein binding transferrin receptor binding signaling receptor binding natural killer cell lectin like receptor bindingKlitinna komponenta integral component of membrane recycling endosome HFE transferrin receptor complex membrana basal part of cell klitinna membrana apical part of cell integral component of plasma membrane terminal web early endosome MHC class I protein complex perinuclear region of cytoplasm GO 0016023 cytoplasmic vesicle external side of plasma membrane mizhklitinnij prostirBiologichnij proces negative regulation of T cell antigen processing and presentation positive regulation of peptide hormone secretion positive regulation of receptor mediated endocytosis cellular response to iron ion antigen processing and presentation negative regulation of receptor binding regulation of protein localization to cell surface antigen processing and presentation of peptide antigen via MHC class I zhinocha vagitnist positive regulation of pathway restricted SMAD protein phosphorylation response to iron ion starvation iron ion homeostasis negative regulation of antigen processing and presentation of endogenous peptide antigen via MHC class I ion transport BMP signaling pathway cellular response to iron ion starvation response to iron ion multicellular organismal iron ion homeostasis positive regulation of ferrous iron binding positive regulation of transferrin receptor binding positive regulation of signaling receptor activity liver regeneration GO 1901313 positive regulation of gene expression negative regulation of T cell cytokine production acute phase response negative regulation of proteasomal ubiquitin dependent protein catabolic process negative regulation of ubiquitin dependent protein catabolic process positive regulation of receptor binding negative regulation of signaling receptor activity positive regulation of protein binding hormone biosynthetic process negative regulation of CD8 positive alpha beta T cell activation cellular iron ion homeostasis iron ion import across plasma membrane transferrin transport GO 0034622 protein containing complex assembly T cell mediated cytotoxicity GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid natural killer cell activation natural killer cell mediated cytotoxicity susceptibility to natural killer cell mediated cytotoxicity GO 1900400 regulation of iron ion transportDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3077 29199Ensembl ENSG00000010704 ENSRNOG00000016967UniProt Q30201 O35799RefSeq mRNK NM 000410 NM 001300749 NM 139002 NM 139003 NM 139004NM 139005 NM 139006 NM 139007 NM 139008 NM 139009 NM 139010 NM 139011 NM 001384164NM 001173434 NM 001173435 NM 053301RefSeq bilok NP 000401 NP 001287678 NP 620572 NP 620573 NP 620575NP 620576 NP 620577 NP 620578 NP 620579 NP 620580 NP 001371093NP 001166905 NP 001166906 NP 445753Lokus UCSC Hr 6 26 09 26 1 Mbn dPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEAL GYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTV DFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRG VLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKE FEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak transport ioniv transport zaliza transport alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionom zaliza Lokalizovanij u klitinnij membrani membrani LiteraturaAlbig W Drabent B Burmester N Bode C Doenecke D 1998 The haemochromatosis candidate gene HFE HLA H of man and mouse is located in syntenic regions within the histone gene J Cell Biochem 69 117 126 PMID 9548560 DOI 10 1002 SICI 1097 4644 19980501 69 2 lt 117 AID JCB3 gt 3 0 CO 2 V Rhodes D A Trowsdale J 1999 Alternate splice variants of the hemochromatosis gene Hfe Immunogenetics 49 357 359 PMID 10079302 DOI 10 1007 s002510050505 Sanchez M Bruguera M Rodos J Oliva R 2001 Complete characterization of the 3 region of the human and mouse hereditary hemochromatosis HFE gene and detection of novel splicing forms Blood Cells Mol Dis 27 35 43 PMID 11358357 DOI 10 1006 bcmd 2000 0346 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bennett M J Lebron J A Bjorkman P J 2000 Crystal structure of the hereditary haemochromatosis protein HFE complexed with transferrin receptor Nature 403 46 53 PMID 10638746 DOI 10 1038 47417 Hillman R T Green R E Brenner S E 2004 An unappreciated role for RNA surveillance Genome Biol 5 R8 1 R8 16 PMID 14759258 DOI 10 1186 gb 2004 5 2 r8PrimitkiZahvoryuvannya genetichno pov yazani z HFE pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4886 angl Procitovano 6 veresnya 2017 angl Arhiv originalu za 1 veresnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ