CCR7 (англ. C-C motif chemokine receptor 7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 378 амінокислот, а молекулярна маса — 42 874.
CCR7 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | CCR7, BLR2, CC-CKR-7, CCR-7, CD197, CDw197, CMKBR7, EBI1, C-C motif chemokine receptor 7 | ||||||||||||||||
Зовнішні ІД | OMIM: 600242 MGI: 103011 HomoloGene: 1387 GeneCards: CCR7 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 17: 40.55 – 40.57 Mb | Хр. 11: 99.04 – 99.05 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MDLGKPMKSV | LVVALLVIFQ | VCLCQDEVTD | DYIGDNTTVD | YTLFESLCSK | ||||
KDVRNFKAWF | LPIMYSIICF | VGLLGNGLVV | LTYIYFKRLK | TMTDTYLLNL | ||||
AVADILFLLT | LPFWAYSAAK | SWVFGVHFCK | LIFAIYKMSF | FSGMLLLLCI | ||||
SIDRYVAIVQ | AVSAHRHRAR | VLLISKLSCV | GIWILATVLS | IPELLYSDLQ | ||||
RSSSEQAMRC | SLITEHVEAF | ITIQVAQMVI | GFLVPLLAMS | FCYLVIIRTL | ||||
LQARNFERNK | AIKVIIAVVV | VFIVFQLPYN | GVVLAQTVAN | FNITSSTCEL | ||||
SKQLNIAYDV | TYSLACVRCC | VNPFLYAFIG | VKFRNDLFKL | FKDLGCLSQE | ||||
QLRQWSSCRH | IRRSSMSVEA | ETTTTFSP |
Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, . Локалізований у клітинній мембрані, мембрані.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Birkenbach M.P., Josefsen K., Yalamanchili R.R., Lenoir G.M., Kieff E. (1993). Epstein-Barr virus-induced genes: first lymphocyte-specific G protein-coupled peptide receptors. J. Virol. 67: 2209—2220. PMID 8383238
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1608 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 29 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CCR7 angl C C motif chemokine receptor 7 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 378 aminokislot a molekulyarna masa 42 874 CCR7IdentifikatoriSimvoliCCR7 BLR2 CC CKR 7 CCR 7 CD197 CDw197 CMKBR7 EBI1 C C motif chemokine receptor 7Zovnishni ID OMIM 600242 MGI 103011 HomoloGene 1387 GeneCards CCR7Ontologiya genaMolekulyarna funkciya C C motif chemokine 19 receptor activity C C motif chemokine 21 receptor activity G protein coupled receptor activity chemokine C C motif ligand 19 binding chemokine C C motif ligand 21 binding signal transducer activity chemokine receptor activity C C chemokine receptor activity chemokine binding C C chemokine bindingKlitinna komponenta integral component of membrane membrana klitinna membrana vnutrishnoklitinnij cell surface external side of plasma membrane mitohondriyaBiologichnij proces G protein coupled receptor signaling pathway release of sequestered calcium ion into cytosol positive regulation of protein kinase B signaling positive regulation of cell motility positive regulation of glycoprotein biosynthetic process involved in immunological synapse formation positive regulation of actin filament polymerization lymphocyte migration into lymph node homeostasis of number of cells positive regulation of interleukin 12 production positive regulation of hypersensitivity GO 0032861 GO 0032862 GO 0032856 activation of GTPase activity ruffle organization positive regulation of cell matrix adhesion positive regulation of cytosolic calcium ion concentration positive regulation of T cell receptor signaling pathway regulation of interferon gamma production response to nitric oxide regulation of dendritic cell dendrite assembly positive regulation of JNK cascade myeloid dendritic cell chemotaxis dendritic cell chemotaxis cellular response to cytokine stimulus negative thymic T cell selection positive regulation of phosphatidylinositol 3 kinase activity hemotaksis positive regulation of immunological synapse formation response to prostaglandin E response to lipopolysaccharide positive regulation of dendritic cell antigen processing and presentation positive regulation of pseudopodium assembly positive regulation of humoral immune response GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid establishment of T cell polarity positive regulation of ERK1 and ERK2 cascade positive regulation of neutrophil chemotaxis positive regulation of I kappaB kinase NF kappaB signaling positive regulation of T cell costimulation inflammatory response mature conventional dendritic cell differentiation positive regulation of filopodium assembly positive regulation of dendritic cell chemotaxis GO 0072468 signalna transdukciya positive regulation of cell adhesion positive regulation of protein kinase activity chemokine mediated signaling pathway chemokine C C motif ligand 19 signaling pathway chemokine C C motif ligand 21 signaling pathway negative regulation of dendritic cell apoptotic process calcium mediated signaling cell chemotaxisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1236 12775Ensembl ENSG00000126353 ENSMUSG00000037944UniProt P32248 P47774RefSeq mRNK NM 001838 NM 001301714 NM 001301716 NM 001301717 NM 001301718NM 001301713 NM 007719RefSeq bilok NP 001288643 NP 001288645 NP 001288646 NP 001288647 NP 001829NP 001288642 NP 031745Lokus UCSC Hr 17 40 55 40 57 MbHr 11 99 04 99 05 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSK KDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL AVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCI SIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQ RSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTL LQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQE QLRQWSSCRHIRRSSMSVEAETTTTFSP A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv Lokalizovanij u klitinnij membrani membrani LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Birkenbach M P Josefsen K Yalamanchili R R Lenoir G M Kieff E 1993 Epstein Barr virus induced genes first lymphocyte specific G protein coupled peptide receptors J Virol 67 2209 2220 PMID 8383238PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1608 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 29 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 17 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi