TGFBR2 (англ. Transforming growth factor beta receptor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 567 амінокислот, а молекулярна маса — 64 568.
TGFBR2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | TGFBR2, AAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TGFR-2, TGFbeta-RII, transforming growth factor beta receptor 2, TBR-ii, TBRII | ||||||||||||||||
Зовнішні ІД | OMIM: 190182 MGI: 98729 HomoloGene: 2435 GeneCards: TGFBR2 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
рак молочної залози, Loeys-Dietz syndrome 2, Loeys-Dietz syndrome, Marfan syndrome type 2 | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 3: 30.61 – 30.69 Mb | Хр. 9: 115.91 – 116 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MGRGLLRGLW | PLHIVLWTRI | ASTIPPHVQK | SVNNDMIVTD | NNGAVKFPQL | ||||
CKFCDVRFST | CDNQKSCMSN | CSITSICEKP | QEVCVAVWRK | NDENITLETV | ||||
CHDPKLPYHD | FILEDAASPK | CIMKEKKKPG | ETFFMCSCSS | DECNDNIIFS | ||||
EEYNTSNPDL | LLVIFQVTGI | SLLPPLGVAI | SVIIIFYCYR | VNRQQKLSST | ||||
WETGKTRKLM | EFSEHCAIIL | EDDRSDISST | CANNINHNTE | LLPIELDTLV | ||||
GKGRFAEVYK | AKLKQNTSEQ | FETVAVKIFP | YEEYASWKTE | KDIFSDINLK | ||||
HENILQFLTA | EERKTELGKQ | YWLITAFHAK | GNLQEYLTRH | VISWEDLRKL | ||||
GSSLARGIAH | LHSDHTPCGR | PKMPIVHRDL | KSSNILVKND | LTCCLCDFGL | ||||
SLRLDPTLSV | DDLANSGQVG | TARYMAPEVL | ESRMNLENVE | SFKQTDVYSM | ||||
ALVLWEMTSR | CNAVGEVKDY | EPPFGSKVRE | HPCVESMKDN | VLRDRGRPEI | ||||
PSFWLNHQGI | QMVCETLTEC | WDHDPEARLT | AQCVAERFSE | LEHLDRLSGR | ||||
SCSEEKIPED | GSLNTTK |
Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, регуляція росту, диференціація, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами, іонами металів, іоном магнію, іоном марганцю. Локалізований у клітинній мембрані, мембрані.
Література
- Lin H.Y., Wang X.-F., Ng-Eaton E., Weinberg R.A., Lodish H.F. (1992). Expression cloning of the TGF-beta type II receptor, a functional transmembrane serine/threonine kinase. Cell. 68: 775—785. PMID 1310899 DOI:10.1016/0092-8674(92)90152-3
- Nikawa J. (1994). A cDNA encoding the human transforming growth factor beta receptor suppresses the growth defect of a yeast mutant. Gene. 149: 367—372. PMID 7959019 DOI:10.1016/0378-1119(94)90178-3
- Ogasa H., Noma T., Murata H., Kawai S., Nakazawa A. (1996). Cloning of a cDNA encoding the human transforming growth factor-beta type II receptor: heterogeneity of the mRNA. Gene. 181: 185—190. PMID 8973329 DOI:10.1016/S0378-1119(96)00501-X
- Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504
- Tsukazaki T., Chiang T.A., Davison A.F., Attisano L., Wrana J.L. (1998). SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor. Cell. 95: 779—791. PMID 9865696 DOI:10.1016/S0092-8674(00)81701-8
- Gilboa L., Wells R.G., Lodish H.F., Henis Y.I. (1998). Oligomeric structure of type I and type II transforming growth factor beta receptors: homodimers form in the ER and persist at the plasma membrane. J. Cell Biol. 140: 767—777. PMID 9472030 DOI:10.1083/jcb.140.4.767
Примітки
- Захворювання, генетично пов'язані з TGFBR2 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 1 квітня 2016. Процитовано 30 серпня 2017.
- (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 30 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
TGFBR2 angl Transforming growth factor beta receptor 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 567 aminokislot a molekulyarna masa 64 568 TGFBR2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1KTZ 1M9Z 1PLO 2PJY 3KFD 4P7U 4XJJ 5E92 5E91 5E8V 5E8YIdentifikatoriSimvoliTGFBR2 AAT3 FAA3 LDS1B LDS2 LDS2B MFS2 RIIC TAAD2 TGFR 2 TGFbeta RII transforming growth factor beta receptor 2 TBR ii TBRIIZovnishni ID OMIM 190182 MGI 98729 HomoloGene 2435 GeneCards TGFBR2Pov yazani genetichni zahvoryuvannyarak molochnoyi zalozi Loeys Dietz syndrome 2 Loeys Dietz syndrome Marfan syndrome type 2 Ontologiya genaMolekulyarna funkciya transforming growth factor beta activated receptor activity kinase activity ATP binding type III transforming growth factor beta receptor binding protein kinase activity transforming growth factor beta receptor activity type II zv yazuvannya z ionom metalu protein serine threonine kinase activity transferase activity type I transforming growth factor beta receptor binding mitogen activated protein kinase kinase kinase binding GO 0001948 GO 0016582 protein binding SMAD binding nucleotide binding glycosaminoglycan binding transforming growth factor beta binding transmembrane receptor protein serine threonine kinase activity signaling receptor activity growth factor bindingKlitinna komponenta citoplazma gialoplazma membrana caveola cell surface membrane raft integral component of membrane receptor complex klitinna membrana integral component of plasma membrane external side of plasma membraneBiologichnij proces growth plate cartilage development response to cholesterol lens fiber cell apoptotic process response to steroid hormone positive regulation of T cell tolerance induction receptor oposeredkovanij endocitoz response to organic substance vaskulogenez protein phosphorylation positive regulation of B cell tolerance induction positive regulation of reactive oxygen species metabolic process blood vessel development positive regulation of mesenchymal cell proliferation animal organ regeneration animal organ morphogenesis transforming growth factor beta receptor signaling pathway embryo implantation negative regulation of cell population proliferation GO 0097285 apoptoz pathway restricted SMAD protein phosphorylation common partner SMAD protein phosphorylation bronchus morphogenesis lung development response to mechanical stimulus positive regulation of epithelial cell migration in utero embryonic development negative regulation of transforming growth factor beta receptor signaling pathway heart development cartilage development positive regulation of tolerance induction to self antigen branching involved in blood vessel morphogenesis positive regulation of skeletal muscle tissue regeneration smoothened signaling pathway negative regulation of cardiac muscle cell proliferation Signalnij shlyah Notch diferenciaciya klitin fosforilyuvannya response to nutrient mammary gland morphogenesis Zagoyennya ran response to glucose positive regulation of epithelial to mesenchymal transition positive regulation of angiogenesis response to estrogen gastrulyaciya regulyaciya ekspresiyi geniv embryonic cranial skeleton morphogenesis peptidyl threonine phosphorylation trachea formation lung lobe morphogenesis positive regulation of smooth muscle cell proliferation lung morphogenesis GO 1904578 response to organic cyclic compound trachea morphogenesis GO 0010260 starinnya lyudini myeloid dendritic cell differentiation bronchus development brain development transmembrane receptor protein serine threonine kinase signaling pathway lens development in camera type eye regulation of cell population proliferation GO 0035404 peptidyl serine phosphorylation positive regulation of cell population proliferation embryonic hemopoiesis growth plate cartilage chondrocyte growth regulation of growth positive regulation of NK T cell differentiation digestive tract development activation of protein kinase activity response to hypoxia heart looping outflow tract septum morphogenesis membranous septum morphogenesis outflow tract morphogenesis atrioventricular valve morphogenesis tricuspid valve morphogenesis cardiac left ventricle morphogenesis endocardial cushion fusion ventricular septum morphogenesis positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation cell proliferation involved in endocardial cushion morphogenesis positive regulation of CD4 positive alpha beta T cell proliferation superior endocardial cushion morphogenesis inferior endocardial cushion morphogenesis miRNA transport secondary palate development pattern specification processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7048 21813Ensembl ENSG00000163513 ENSMUSG00000032440UniProt P37173 Q62312RefSeq mRNK NM 001024847 NM 003242NM 009371 NM 029575RefSeq bilok NP 001020018 NP 003233NP 033397 NP 083851Lokus UCSC Hr 3 30 61 30 69 MbHr 9 115 91 116 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQL CKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETV CHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFS EEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSST WETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLV GKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKL GSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGL SLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSM ALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEI PSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGR SCSEEKIPEDGSLNTTK A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz serin treoninovih proteyinkinaz receptoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz regulyaciya rostu diferenciaciya polimorfizm alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami ionami metaliv ionom magniyu ionom margancyu Lokalizovanij u klitinnij membrani membrani LiteraturaLin H Y Wang X F Ng Eaton E Weinberg R A Lodish H F 1992 Expression cloning of the TGF beta type II receptor a functional transmembrane serine threonine kinase Cell 68 775 785 PMID 1310899 DOI 10 1016 0092 8674 92 90152 3 Nikawa J 1994 A cDNA encoding the human transforming growth factor beta receptor suppresses the growth defect of a yeast mutant Gene 149 367 372 PMID 7959019 DOI 10 1016 0378 1119 94 90178 3 Ogasa H Noma T Murata H Kawai S Nakazawa A 1996 Cloning of a cDNA encoding the human transforming growth factor beta type II receptor heterogeneity of the mRNA Gene 181 185 190 PMID 8973329 DOI 10 1016 S0378 1119 96 00501 X Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504 Tsukazaki T Chiang T A Davison A F Attisano L Wrana J L 1998 SARA a FYVE domain protein that recruits Smad2 to the TGFbeta receptor Cell 95 779 791 PMID 9865696 DOI 10 1016 S0092 8674 00 81701 8 Gilboa L Wells R G Lodish H F Henis Y I 1998 Oligomeric structure of type I and type II transforming growth factor beta receptors homodimers form in the ER and persist at the plasma membrane J Cell Biol 140 767 777 PMID 9472030 DOI 10 1083 jcb 140 4 767PrimitkiZahvoryuvannya genetichno pov yazani z TGFBR2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 1 kvitnya 2016 Procitovano 30 serpnya 2017 angl Arhiv originalu za 1 veresnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 3 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi