Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CDC20 англ Cell division cycle 20 білок який кодується однойменним геном розташованим у людей на короткому плечі 1 ї хро

CDC20

CDC20

CDC20 (англ. Cell division cycle 20) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 499 амінокислот, а молекулярна маса — 54 723.

CDC20
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CDC20, CDC20A, bA276H19.3, p55CDC, cell division cycle 20
Зовнішні ІД OMIM: 603618 MGI: 1859866 HomoloGene: 37459 GeneCards: CDC20
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
991
107995
Ensembl
ENSG00000117399
ENSMUSG00000006398
UniProt
Q12834
Q9JJ66
RefSeq (мРНК)
NM_001255
NM_023223
RefSeq (білок)
NP_001246
NP_075712
Локус (UCSC) Хр. 1: 43.36 – 43.36 Mb Хр. 4: 118.29 – 118.29 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH
SAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ
PENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKV
LYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAV
ALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEV
QLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQT
FTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHS
QVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLT
MSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як клітинний цикл, поділ клітини, мітоз, убіквітинування білків, диференціація, нейрогенез, поліморфізм, ацетиляція. Локалізований у цитоплазмі, цитоскелеті.

Література

  • Weinstein J., Jacobsen F.W., Hsu-Chen J., Wu T., Baum L.G. (1994). A novel mammalian protein, p55CDC, present in dividing cells is associated with protein kinase activity and has homology to the Saccharomyces cerevisiae cell division cycle proteins Cdc20 and Cdc4. Mol. Cell. Biol. 14: 3350—3363. PMID 7513050 DOI:10.1128/MCB.14.5.3350
  • Kramer E.R., Gieffers C., Hoelzl G., Hengstschlaeger M., Peters J.-M. (1998). Activation of the human anaphase-promoting complex by proteins of the CDC20/Fizzy family. Curr. Biol. 8: 1207—1210. PMID 9811605 DOI:10.1016/S0960-9822(07)00510-6
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Fang G., Yu H., Kirschner M.W. (1998). Direct binding of CDC20 protein family members activates the anaphase-promoting complex in mitosis and G1. Mol. Cell. 2: 163—171. PMID 9734353 DOI:10.1016/S1097-2765(00)80126-4
  • Fang G., Yu H., Kirschner M.W. (1998). The checkpoint protein MAD2 and the mitotic regulator CDC20 form a ternary complex with the anaphase-promoting complex to control anaphase initiation. Genes Dev. 12: 1871—1883. PMID 9637688 DOI:10.1101/gad.12.12.1871
  • Kotani S., Tanaka H., Yasuda H., Todokoro K. (1999). Regulation of APC activity by phosphorylation and regulatory factors. J. Cell Biol. 146: 791—800. PMID 10459014 DOI:10.1083/jcb.146.4.791

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 12 червня 2017. Процитовано 25 серпня 2017.
  4. (англ.) . Архів оригіналу за 22 липня 2017. Процитовано 25 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CDC20 angl Cell division cycle 20 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 499 aminokislot a molekulyarna masa 54 723 CDC20Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4GGA 4GGC 4GGD 4N14 5G04IdentifikatoriSimvoliCDC20 CDC20A bA276H19 3 p55CDC cell division cycle 20Zovnishni ID OMIM 603618 MGI 1859866 HomoloGene 37459 GeneCards CDC20Ontologiya genaMolekulyarna funkciya protein C terminus binding GO 0001948 GO 0016582 protein binding anaphase promoting complex binding ubiquitin protein transferase activator activity enzyme binding histone deacetylase bindingKlitinna komponenta centrosoma spindle pole vereteno podilu centr organizaciyi mikrotrubochok perinuclear region of cytoplasm anaphase promoting complex citoskelet citoplazma klitinne yadro nukleoplazma gialoplazma GO 0009327 protein containing complexBiologichnij proces diferenciaciya klitin regulation of meiotic nuclear division regulation of dendrite development nejrobiologiya rozvitku positive regulation of synaptic plasticity podil klitini positive regulation of synapse maturation Ubikvitin zalezhnij proteoliz positive regulation of cell population proliferation anaphase promoting complex dependent catabolic process GO 0090623 GO 1903835 GO 0007092 GO 0051488 GO 0051487 positive regulation of ubiquitin protein ligase activity mitotic sister chromatid cohesion protein deubiquitination mitotic spindle assembly klitinnij cikl mitotic spindle assembly checkpoint signaling regulation of mitotic cell cycle phase transition ubiquitin dependent protein catabolic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez991 107995Ensembl ENSG00000117399 ENSMUSG00000006398UniProt Q12834 Q9JJ66RefSeq mRNK NM 001255NM 023223RefSeq bilok NP 001246NP 075712Lokus UCSC Hr 1 43 36 43 36 MbHr 4 118 29 118 29 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH SAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ PENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKV LYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAV ALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEV QLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEH HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQT FTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHS QVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLT MSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl podil klitini mitoz ubikvitinuvannya bilkiv diferenciaciya nejrogenez polimorfizm acetilyaciya Lokalizovanij u citoplazmi citoskeleti LiteraturaWeinstein J Jacobsen F W Hsu Chen J Wu T Baum L G 1994 A novel mammalian protein p55CDC present in dividing cells is associated with protein kinase activity and has homology to the Saccharomyces cerevisiae cell division cycle proteins Cdc20 and Cdc4 Mol Cell Biol 14 3350 3363 PMID 7513050 DOI 10 1128 MCB 14 5 3350 Kramer E R Gieffers C Hoelzl G Hengstschlaeger M Peters J M 1998 Activation of the human anaphase promoting complex by proteins of the CDC20 Fizzy family Curr Biol 8 1207 1210 PMID 9811605 DOI 10 1016 S0960 9822 07 00510 6 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Fang G Yu H Kirschner M W 1998 Direct binding of CDC20 protein family members activates the anaphase promoting complex in mitosis and G1 Mol Cell 2 163 171 PMID 9734353 DOI 10 1016 S1097 2765 00 80126 4 Fang G Yu H Kirschner M W 1998 The checkpoint protein MAD2 and the mitotic regulator CDC20 form a ternary complex with the anaphase promoting complex to control anaphase initiation Genes Dev 12 1871 1883 PMID 9637688 DOI 10 1101 gad 12 12 1871 Kotani S Tanaka H Yasuda H Todokoro K 1999 Regulation of APC activity by phosphorylation and regulatory factors J Cell Biol 146 791 800 PMID 10459014 DOI 10 1083 jcb 146 4 791PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 12 chervnya 2017 Procitovano 25 serpnya 2017 angl Arhiv originalu za 22 lipnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ