Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

NKX2 1 англ NK2 homeobox 1 білок який кодується однойменним геном розташованим у людей на короткому плечі 14 ї хромосоми

NKX2-1

NKX2-1

NKX2-1 (англ. NK2 homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми. Довжина поліпептидного ланцюга білка становить 371 амінокислот, а молекулярна маса — 38 596.

NKX2-1
image
Ідентифікатори
Символи NKX2-1, Nkx2-1, AV026640, Nkx2.1, T/EBP, Titf1, Ttf-1, BCH, BHC, NK-2, NKX2A, TEBP, TTF1, NMTC1, NK2 homeobox 1
Зовнішні ІД OMIM: 600635 MGI: 108067 HomoloGene: 2488 GeneCards: NKX2-1
Пов'язані генетичні захворювання
хорея, brain-lung-thyroid syndrome
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
7080
21869
Ensembl
ENSG00000136352
ENSMUSG00000001496
UniProt
P43699
P50220
RefSeq (мРНК)
NM_001079668
NM_003317
NM_001146198
NM_009385
RefSeq (білок)
NP_001073136
NP_003308
NP_033411
NP_001390509
Локус (UCSC) Хр. 14: 36.52 – 36.52 Mb Хр. 12: 56.58 – 56.58 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPT
AAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPY
QDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVS
KNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHL
TPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQA
QQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAA
AAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL
NSSGSDYGTMSCSTLLYGRTW

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • Oguchi H., Pan Y.-T., Kimura S. (1995). The complete nucleotide sequence of the mouse thyroid-specific enhancer-binding protein (T/EBP) gene: extensive identity of the deduced amino acid sequence with the human protein. Biochim. Biophys. Acta. 1261: 304—306. PMID 7711079 DOI:10.1016/0167-4781(95)00033-D
  • Saiardi A., Tassi V., de Filippis V., Civitareale D. (1995). Cloning and sequence analysis of human thyroid transcription factor 1. Biochim. Biophys. Acta. 1261: 307—310. PMID 7711080 DOI:10.1016/0167-4781(95)00034-E
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Doyle D.A., Gonzalez I., Thomas B., Scavina M. (2004). Autosomal dominant transmission of congenital hypothyroidism, neonatal respiratory distress, and ataxia caused by a mutation of NKX2-1. J. Pediatr. 145: 190—193. PMID 15289765 DOI:10.1016/j.jpeds.2004.04.011
  • Williamson S., Kirkpatrick M., Greene S., Goudie D. (2014). A novel mutation of NKX2-1 affecting 2 generations with hypothyroidism and choreoathetosis: part of the spectrum of brain-thyroid-lung syndrome. J. Child Neurol. 29: 666—669. PMID 24453141 DOI:10.1177/0883073813518243

Примітки

  1. Захворювання, генетично пов'язані з NKX2-1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 26 березня 2016. Процитовано 11 вересня 2017.
  5. (англ.) . Архів оригіналу за 29 серпня 2017. Процитовано 11 вересня 2017.

Див. також


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

NKX2 1 angl NK2 homeobox 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 371 aminokislot a molekulyarna masa 38 596 NKX2 1IdentifikatoriSimvoliNKX2 1 Nkx2 1 AV026640 Nkx2 1 T EBP Titf1 Ttf 1 BCH BHC NK 2 NKX2A TEBP TTF1 NMTC1 NK2 homeobox 1Zovnishni ID OMIM 600635 MGI 108067 HomoloGene 2488 GeneCards NKX2 1Pov yazani genetichni zahvoryuvannyahoreya brain lung thyroid syndrome Ontologiya genaMolekulyarna funkciya DNA binding sequence specific DNA binding GO 0001948 GO 0016582 protein binding enzyme binding RNA polymerase II transcription regulatory region sequence specific DNA binding intronic transcription regulatory region sequence specific DNA binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity transcription factor activity RNA polymerase II distal enhancer sequence specific binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA bindingKlitinna komponenta nukleoplazma klitinne yadro transcription regulator complexBiologichnij proces GO 0009373 regulation of transcription DNA templated ritmichnij proces negative regulation of transforming growth factor beta receptor signaling pathway transcription DNA templated GO 1901313 positive regulation of gene expression negative regulation of cell migration response to hormone forebrain development epithelial tube branching involved in lung morphogenesis negative regulation of epithelial to mesenchymal transition GO 1901227 negative regulation of transcription by RNA polymerase II neuron migration GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II phospholipid metabolic process pattern specification process axon guidance brain development endoderm development locomotory behavior animal organ morphogenesis telencephalon development globus pallidus development hippocampus development cerebral cortex cell migration forebrain dorsal ventral pattern formation forebrain neuron fate commitment forebrain neuron differentiation cerebral cortex GABAergic interneuron differentiation cerebral cortex neuron differentiation pituitary gland development telencephalon cell migration lung development thyroid gland development developmental induction Leydig cell differentiation positive regulation of circadian rhythm GO 0045996 negative regulation of transcription DNA templated GO 0060469 GO 0009371 positive regulation of transcription DNA templated GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II anatomical structure formation involved in morphogenesis neuron fate commitment oligodendrocyte differentiation lung saccule development club cell differentiation type II pneumocyte differentiation diferenciaciya klitinDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7080 21869Ensembl ENSG00000136352 ENSMUSG00000001496UniProt P43699 P50220RefSeq mRNK NM 001079668 NM 003317NM 001146198 NM 009385RefSeq bilok NP 001073136 NP 003308NP 033411 NP 001390509Lokus UCSC Hr 14 36 52 36 52 MbHr 12 56 58 56 58 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPT AAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPY QDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVS KNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHL TPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQA QQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAA AAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHL NSSGSDYGTMSCSTLLYGRTW A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi biologichni ritmi alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaOguchi H Pan Y T Kimura S 1995 The complete nucleotide sequence of the mouse thyroid specific enhancer binding protein T EBP gene extensive identity of the deduced amino acid sequence with the human protein Biochim Biophys Acta 1261 304 306 PMID 7711079 DOI 10 1016 0167 4781 95 00033 D Saiardi A Tassi V de Filippis V Civitareale D 1995 Cloning and sequence analysis of human thyroid transcription factor 1 Biochim Biophys Acta 1261 307 310 PMID 7711080 DOI 10 1016 0167 4781 95 00034 E The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Doyle D A Gonzalez I Thomas B Scavina M 2004 Autosomal dominant transmission of congenital hypothyroidism neonatal respiratory distress and ataxia caused by a mutation of NKX2 1 J Pediatr 145 190 193 PMID 15289765 DOI 10 1016 j jpeds 2004 04 011 Williamson S Kirkpatrick M Greene S Goudie D 2014 A novel mutation of NKX2 1 affecting 2 generations with hypothyroidism and choreoathetosis part of the spectrum of brain thyroid lung syndrome J Child Neurol 29 666 669 PMID 24453141 DOI 10 1177 0883073813518243PrimitkiZahvoryuvannya genetichno pov yazani z NKX2 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 26 bereznya 2016 Procitovano 11 veresnya 2017 angl Arhiv originalu za 29 serpnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 14 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ