FEN1 (англ. Flap structure-specific endonuclease 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 380 амінокислот, а молекулярна маса — 42 593.
FEN1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | FEN1, Flap endonuclease 1, flap structure-specific endonuclease 1, FEN-1, MF1, RAD2 | ||||||||||||||||
Зовнішні ІД | OMIM: 600393 MGI: 102779 HomoloGene: 3034 GeneCards: FEN1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 61.79 – 61.8 Mb | Хр. 19: 10.18 – 10.18 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MGIQGLAKLI | ADVAPSAIRE | NDIKSYFGRK | VAIDASMSIY | QFLIAVRQGG | ||||
DVLQNEEGET | TSHLMGMFYR | TIRMMENGIK | PVYVFDGKPP | QLKSGELAKR | ||||
SERRAEAEKQ | LQQAQAAGAE | QEVEKFTKRL | VKVTKQHNDE | CKHLLSLMGI | ||||
PYLDAPSEAE | ASCAALVKAG | KVYAAATEDM | DCLTFGSPVL | MRHLTASEAK | ||||
KLPIQEFHLS | RILQELGLNQ | EQFVDLCILL | GSDYCESIRG | IGPKRAVDLI | ||||
QKHKSIEEIV | RRLDPNKYPV | PENWLHKEAH | QLFLEPEVLD | PESVELKWSE | ||||
PNEEELIKFM | CGEKQFSEER | IRSGVKRLSK | SRQGSTQGRL | DDFFKVTGSL | ||||
SSAKRKEPEP | KGSTKKKAKT | GAAGKFKRGK |
Кодований геном білок за функціями належить до гідролаз, екзонуклеаз, нуклеаз, ендонуклеаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як пошкодження ДНК, репарація ДНК, реплікація ДНК, ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном магнію. Локалізований у ядрі, мітохондрії.
Література
- Hiraoka L.R., Harrington J.J., Gerhard D.S., Lieber M.R., Hsieh C.-L. (1995). Sequence of human FEN-1, a structure-specific endonuclease, and chromosomal localization of the gene (FEN1) in mouse and human. Genomics. 25: 220—225. PMID 7774922 DOI:10.1016/0888-7543(95)80129-A
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Shen B., Nolan J.P., Sklar L.A., Park M.S. (1996). Essential amino acids for substrate binding and catalysis of human flap endonuclease 1. J. Biol. Chem. 271: 9173—9176. PMID 8621570 DOI:10.1074/jbc.271.16.9173
- Gary R., Ludwig D.L., Cornelius H.L., MacInnes M.A., Park M.S. (1997). The DNA repair endonuclease XPG binds to proliferating cell nuclear antigen (PCNA) and shares sequence elements with the PCNA-binding regions of FEN-1 and cyclin-dependent kinase inhibitor p21. J. Biol. Chem. 272: 24522—24529. PMID 9305916 DOI:10.1074/jbc.272.39.24522
- Tom S., Henricksen L.A., Bambara R.A. (2000). Mechanism whereby proliferating cell nuclear antigen stimulates flap endonuclease 1. J. Biol. Chem. 275: 10498—10505. PMID 10744741 DOI:10.1074/jbc.275.14.10498
- Qiu J., Bimston D.N., Partikian A., Shen B. (2002). Arginine residues 47 and 70 of human flap endonuclease-1 are involved in DNA substrate interactions and cleavage site determination. J. Biol. Chem. 277: 24659—24666. PMID 11986308 DOI:10.1074/jbc.M111941200
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:3650 (англ.) . Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 18 серпня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
FEN1 angl Flap structure specific endonuclease 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 380 aminokislot a molekulyarna masa 42 593 FEN1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1U7B 1UL1 3Q8K 3Q8L 3Q8M 3UVU 5E0VIdentifikatoriSimvoliFEN1 Flap endonuclease 1 flap structure specific endonuclease 1 FEN 1 MF1 RAD2Zovnishni ID OMIM 600393 MGI 102779 HomoloGene 3034 GeneCards FEN1Ontologiya genaMolekulyarna funkciya zv yazuvannya z ionom metalu RNA DNA hybrid ribonuclease activity hydrolase activity acting on ester bonds nuclease activity hydrolase activity double stranded DNA binding katalitichna aktivnist damaged DNA binding double stranded DNA exodeoxyribonuclease activity GO 0001948 GO 0016582 protein binding DNA binding endonuclease activity exonuclease activity 5 3 exonuclease activity 5 flap endonuclease activity flap endonuclease activity magnesium ion binding manganese ion bindingKlitinna komponenta mitohondriya klitinne yadro membrana nukleoplazma yaderce GO 0009327 protein containing complexBiologichnij proces double strand break repair via homologous recombination double strand break repair pam yat cellular response to DNA damage stimulus UF zahist replikaciya DNK GO 0100026 Reparaciya DNK RNA phosphodiester bond hydrolysis endonucleolytic DNA replication removal of RNA primer positive regulation of sister chromatid cohesion nucleic acid phosphodiester bond hydrolysis telomere maintenance via semi conservative replication base excision repair apoptotic DNA fragmentation retina development in camera type eyeDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2237 14156Ensembl ENSG00000168496 ENSMUSG00000024742UniProt P39748 P39749RefSeq mRNK NM 004111NM 001271614 NM 001271615 NM 007999RefSeq bilok NP 004102n dLokus UCSC Hr 11 61 79 61 8 MbHr 19 10 18 10 18 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGG DVLQNEEGETTSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKR SERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGI PYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAK KLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLI QKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL SSAKRKEPEPKGSTKKKAKTGAAGKFKRGK A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz ekzonukleaz nukleaz endonukleaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak poshkodzhennya DNK reparaciya DNK replikaciya DNK acetilyuvannya Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom magniyu Lokalizovanij u yadri mitohondriyi LiteraturaHiraoka L R Harrington J J Gerhard D S Lieber M R Hsieh C L 1995 Sequence of human FEN 1 a structure specific endonuclease and chromosomal localization of the gene FEN1 in mouse and human Genomics 25 220 225 PMID 7774922 DOI 10 1016 0888 7543 95 80129 A The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Shen B Nolan J P Sklar L A Park M S 1996 Essential amino acids for substrate binding and catalysis of human flap endonuclease 1 J Biol Chem 271 9173 9176 PMID 8621570 DOI 10 1074 jbc 271 16 9173 Gary R Ludwig D L Cornelius H L MacInnes M A Park M S 1997 The DNA repair endonuclease XPG binds to proliferating cell nuclear antigen PCNA and shares sequence elements with the PCNA binding regions of FEN 1 and cyclin dependent kinase inhibitor p21 J Biol Chem 272 24522 24529 PMID 9305916 DOI 10 1074 jbc 272 39 24522 Tom S Henricksen L A Bambara R A 2000 Mechanism whereby proliferating cell nuclear antigen stimulates flap endonuclease 1 J Biol Chem 275 10498 10505 PMID 10744741 DOI 10 1074 jbc 275 14 10498 Qiu J Bimston D N Partikian A Shen B 2002 Arginine residues 47 and 70 of human flap endonuclease 1 are involved in DNA substrate interactions and cleavage site determination J Biol Chem 277 24659 24666 PMID 11986308 DOI 10 1074 jbc M111941200PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3650 angl Procitovano 8 veresnya 2017 angl Arhiv originalu za 18 serpnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi