ATF1 (англ. Activating transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 271 амінокислот, а молекулярна маса — 29 233.
ATF1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | ATF1, EWS-FUS/ATF-1, TREB36, activating transcription factor 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 123803 MGI: 3037720 HomoloGene: 3790 GeneCards: ATF1 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
Angiomatoid fibrous histiocytoma | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 12: 50.76 – 50.82 Mb | Хр. X: 52.89 – 52.89 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEDSHKSTTS | ETAPQPGSAV | QGAHISHIAQ | QVSSLSESEE | SQDSSDSIGS | ||||
SQKAHGILAR | RPSYRKILKD | LSSEDTRGRK | GDGENSGVSA | AVTSMSVPTP | ||||
IYQTSSGQYI | AIAPNGALQL | ASPGTDGVQG | LQTLTMTNSG | STQQGTTILQ | ||||
YAQTSDGQQI | LVPSNQVVVQ | TASGDMQTYQ | IRTTPSATSL | PQTVVMTSPV | ||||
TLTSQTTKTD | DPQLKREIRL | MKNREAAREC | RRKKKEYVKC | LENRVAVLEN | ||||
QNKTLIEELK | TLKDLYSNKS | V |
Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Hai T., Liu F., Coukos W.J., Green M.R. (1989). Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers. Genes Dev. 3: 2083—2090. PMID 2516827 DOI:10.1101/gad.3.12b.2083
- Waters B.L., Panagopoulos I., Allen E.F. (2000). Genetic characterization of angiomatoid fibrous histiocytoma identifies fusion of the FUS and ATF-1 genes induced by a chromosomal translocation involving bands 12q13 and 16p11. Cancer Genet. Cytogenet. 121: 109—116. PMID 11063792 DOI:10.1016/S0165-4608(00)00237-5
- Sun P., Lou L., Maurer R.A. (1996). Regulation of activating transcription factor-1 and the cAMP response element-binding protein by Ca2+/calmodulin-dependent protein kinases type I, II, and IV. J. Biol. Chem. 271: 3066—3073. PMID 8621702 DOI:10.1074/jbc.271.6.3066
- Hailemariam K., Iwasaki K., Huang B.W., Sakamoto K., Tsuji Y. (2010). Transcriptional regulation of ferritin and antioxidant genes by HIPK2 under genotoxic stress. J. Cell Sci. 123: 3863—3871. PMID 20980392 DOI:10.1242/jcs.073627
- Yoshimura T., Fujisawa J., Yoshida M. (1990). Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain. EMBO J. 9: 2537—2542. PMID 2196176
Примітки
- Захворювання, генетично пов'язані з ATF1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:783 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
ATF1 angl Activating transcription factor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 271 aminokislot a molekulyarna masa 29 233 ATF1IdentifikatoriSimvoliATF1 EWS FUS ATF 1 TREB36 activating transcription factor 1Zovnishni ID OMIM 123803 MGI 3037720 HomoloGene 3790 GeneCards ATF1Pov yazani genetichni zahvoryuvannyaAngiomatoid fibrous histiocytoma Ontologiya genaMolekulyarna funkciya DNA binding sequence specific DNA binding RNA polymerase II transcription regulatory region sequence specific DNA binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific GO 0001948 GO 0016582 protein binding protein heterodimerization activity transcription factor activity RNA polymerase II distal enhancer sequence specific binding identical protein binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific GO 0032403 protein containing complex bindingKlitinna komponenta ATF1 ATF4 transcription factor complex transcription regulator complex nukleoplazma klitinne yadroBiologichnij proces GO 0009373 regulation of transcription DNA templated GO 1904578 response to organic cyclic compound transcription DNA templated positive regulation of DNA replication positive regulation of neuron projection development response to cobalt ion GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II transcription by RNA polymerase II GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase IIDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez466 100040260Ensembl ENSG00000123268 ENSMUSG00000080968UniProt P18846 n dRefSeq mRNK NM 005171XM 036162179RefSeq bilok NP 005162n dLokus UCSC Hr 12 50 76 50 82 MbHr X 52 89 52 89 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGS SQKAHGILARRPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTP IYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQ YAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPV TLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLEN QNKTLIEELKTLKDLYSNKSV A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hai T Liu F Coukos W J Green M R 1989 Transcription factor ATF cDNA clones an extensive family of leucine zipper proteins able to selectively form DNA binding heterodimers Genes Dev 3 2083 2090 PMID 2516827 DOI 10 1101 gad 3 12b 2083 Waters B L Panagopoulos I Allen E F 2000 Genetic characterization of angiomatoid fibrous histiocytoma identifies fusion of the FUS and ATF 1 genes induced by a chromosomal translocation involving bands 12q13 and 16p11 Cancer Genet Cytogenet 121 109 116 PMID 11063792 DOI 10 1016 S0165 4608 00 00237 5 Sun P Lou L Maurer R A 1996 Regulation of activating transcription factor 1 and the cAMP response element binding protein by Ca2 calmodulin dependent protein kinases type I II and IV J Biol Chem 271 3066 3073 PMID 8621702 DOI 10 1074 jbc 271 6 3066 Hailemariam K Iwasaki K Huang B W Sakamoto K Tsuji Y 2010 Transcriptional regulation of ferritin and antioxidant genes by HIPK2 under genotoxic stress J Cell Sci 123 3863 3871 PMID 20980392 DOI 10 1242 jcs 073627 Yoshimura T Fujisawa J Yoshida M 1990 Multiple cDNA clones encoding nuclear proteins that bind to the tax dependent enhancer of HTLV 1 all contain a leucine zipper structure and basic amino acid domain EMBO J 9 2537 2542 PMID 2196176PrimitkiZahvoryuvannya genetichno pov yazani z ATF1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 783 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 1 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 12 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi