ICOS (англ. Inducible T-cell costimulator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 199 амінокислот, а молекулярна маса — 22 625.
ICOS | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | ICOS, AILIM, CD278, CVID1, inducible T-cell co-stimulator, inducible T-cell costimulator, inducible T cell costimulator | ||||||||||||||||
Зовнішні ІД | OMIM: 604558 MGI: 1858745 HomoloGene: 8097 GeneCards: ICOS | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 203.94 – 203.96 Mb | Хр. 1: 61.02 – 61.04 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MKSGLWYFFL | FCLRIKVLTG | EINGSANYEM | FIFHNGGVQI | LCKYPDIVQQ | ||||
FKMQLLKGGQ | ILCDLTKTKG | SGNTVSIKSL | KFCHSQLSNN | SVSFFLYNLD | ||||
HSHANYYFCN | LSIFDPPPFK | VTLTGGYLHI | YESQLCCQLK | FWLPIGCAAF | ||||
VVVCILGCIL | ICWLTKKKYS | SSVHDPNGEY | MFMRAVNTAK | KSRLTDVTL |
Задіяний у такому біологічному процесі як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.
Література
- Haaning Andersen A.D., Lange M., Lillevang S.T. (2003). Allelic variation of the inducible costimulator (ICOS) gene: detection of polymorphisms, analysis of the promoter region, and extended haplotype estimation. Tissue Antigens. 61: 276—285. PMID 12753665 DOI:10.1034/j.1399-0039.2003.00019.x
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:5351 (англ.) . Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 12 вересня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
ICOS angl Inducible T cell costimulator bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 199 aminokislot a molekulyarna masa 22 625 ICOSIdentifikatoriSimvoliICOS AILIM CD278 CVID1 inducible T cell co stimulator inducible T cell costimulator inducible T cell costimulatorZovnishni ID OMIM 604558 MGI 1858745 HomoloGene 8097 GeneCards ICOSOntologiya genaMolekulyarna funkciya phosphatidylinositol 4 5 bisphosphate 3 kinase activity GO 0001948 GO 0016582 protein bindingKlitinna komponenta integral component of membrane extracellular region klitinna membrana integral component of plasma membrane membrana external side of plasma membraneBiologichnij proces T cell tolerance induction T cell costimulation GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid phosphatidylinositol phosphate biosynthetic process cell cell adhesion positive regulation of protein kinase B signalingDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez29851 54167Ensembl ENSG00000163600 ENSMUSG00000026009UniProt Q9Y6W8 Q9WVS0RefSeq mRNK NM 012092NM 017480RefSeq bilok NP 036224NP 059508Lokus UCSC Hr 2 203 94 203 96 MbHr 1 61 02 61 04 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTLA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Lokalizovanij u klitinnij membrani membrani Takozh sekretovanij nazovni LiteraturaHaaning Andersen A D Lange M Lillevang S T 2003 Allelic variation of the inducible costimulator ICOS gene detection of polymorphisms analysis of the promoter region and extended haplotype estimation Tissue Antigens 61 276 285 PMID 12753665 DOI 10 1034 j 1399 0039 2003 00019 x The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 5351 angl Procitovano 28 serpnya 2017 angl Arhiv originalu za 12 veresnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi