Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

WNT4 англ Wnt family member 4 білок який кодується однойменним геном розташованим у людей на короткому плечі 1 ї хромосо

WNT4

WNT4

WNT4 (англ. Wnt family member 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 351 амінокислот, а молекулярна маса — 39 052.

WNT4
Ідентифікатори
Символи WNT4, SERKAL, WNT-4, Wnt family member 4
Зовнішні ІД OMIM: 603490 MGI: 98957 HomoloGene: 22529 GeneCards: WNT4
Пов'язані генетичні захворювання
Синдром Маєра — Рокітанського — Кюстера — Гаузера
Ортологи
Види Людина Миша
Entrez
54361
22417
Ensembl
ENSG00000162552
ENSMUSG00000036856
UniProt
P56705
P22724
RefSeq (мРНК)
NM_030761
NM_009523
RefSeq (білок)
NP_110388
NP_033549
Локус (UCSC) Хр. 1: 22.12 – 22.14 Mb Хр. 4: 137 – 137.03 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLI
QRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGK
VVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGF
QWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILT
HMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVG
SSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTC
R

Кодований геном білок за функцією належить до . Задіяний у такому біологічному процесі як сигнальний шлях Wnt. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Biason-Lauber A., Konrad D., Navratil F., Schoenle E.J. (2004). A WNT4 mutation associated with Muellerian-duct regression and virilization in a 46,XX woman. N. Engl. J. Med. 351: 792—798. PMID 15317892 DOI:10.1056/NEJMoa040533
  • Huguet E.L., McMahon J.A., McMahon A.P., Bicknell R., Harris A.L. (1994). Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue. Cancer Res. 54: 2615—2621. PMID 8168088

Примітки

  1. Захворювання, генетично пов'язані з WNT4 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:12783 (англ.) . Процитовано 25 серпня 2017.
  5. (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 25 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

WNT4 angl Wnt family member 4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 351 aminokislot a molekulyarna masa 39 052 WNT4IdentifikatoriSimvoliWNT4 SERKAL WNT 4 Wnt family member 4Zovnishni ID OMIM 603490 MGI 98957 HomoloGene 22529 GeneCards WNT4Pov yazani genetichni zahvoryuvannyaSindrom Mayera Rokitanskogo Kyustera Gauzera Ontologiya genaMolekulyarna funkciya GO 0001106 transcription corepressor activity signaling receptor binding GO 0005110 frizzled binding receptor ligand activityKlitinna komponenta citoplazma endocytic vesicle membrane endoplasmic reticulum lumen extracellular region cell surface ekzosoma klitinna membrana Golgi lumen mizhklitinnij prostir GO 0005578 Pozaklitinna matricyaBiologichnij proces non canonical Wnt signaling pathway T cell differentiation in thymus positive regulation of canonical Wnt signaling pathway negative regulation of male gonad development mesonephros development androgen biosynthetic process gamete generation negative regulation of wound healing metanephros development cellular response to transforming growth factor beta stimulus positive regulation of collagen biosynthetic process mesonephric tubule development cell fate commitment mammary gland epithelium development rozvitok nirki negative regulation of cell differentiation metanephric nephron morphogenesis negative regulation of apoptotic signaling pathway female sex determination tube morphogenesis smooth muscle cell differentiation negative regulation of gene expression female gonad development GO 0060469 GO 0009371 positive regulation of transcription DNA templated GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity branching involved in ureteric bud morphogenesis kidney morphogenesis nephron development paramesonephric duct development thyroid stimulating hormone secreting cell differentiation hormone metabolic process negative regulation of steroid biosynthetic process tertiary branching involved in mammary gland duct morphogenesis diferenciaciya klitin male gonad development positive regulation of aldosterone biosynthetic process positive regulation of bone mineralization GO 1903374 anatomical structure development somatotropin secreting cell differentiation negative regulation of testicular blood vessel morphogenesis metanephric mesenchymal cell differentiation sex differentiation metanephric nephron development oocyte development negative regulation of cell migration positive regulation of osteoblast differentiation renal vesicle formation neuron differentiation regulation of cell cell adhesion Epitelialno mezenhimalnij perehid canonical Wnt signaling pathway GO 0045996 negative regulation of transcription DNA templated branching morphogenesis of an epithelial tube metanephric tubule formation non canonical Wnt signaling pathway via MAPK cascade negative regulation of testosterone biosynthetic process embryonic epithelial tube formation positive regulation of cortisol biosynthetic process positive regulation of dermatome development cellular response to starvation adrenal gland development multicellular organism development negative regulation of fibroblast growth factor receptor signaling pathway renal vesicle induction positive regulation of meiotic nuclear division positive regulation of focal adhesion assembly liver development immature T cell proliferation in thymus positive regulation of stress fiber assembly mesenchymal to epithelial transition Wnt signaling pathway negative regulation of canonical Wnt signaling pathway protein localization to plasma membrane regulation of signaling receptor activity negative regulation of androgen biosynthetic processDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez54361 22417Ensembl ENSG00000162552 ENSMUSG00000036856UniProt P56705 P22724RefSeq mRNK NM 030761NM 009523RefSeq bilok NP 110388NP 033549Lokus UCSC Hr 1 22 12 22 14 MbHr 4 137 137 03 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLI QRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGK VVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGF QWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILT HMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVG SSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTC R A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do Zadiyanij u takomu biologichnomu procesi yak signalnij shlyah Wnt Lokalizovanij u pozaklitinnomu matriksi Takozh sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Biason Lauber A Konrad D Navratil F Schoenle E J 2004 A WNT4 mutation associated with Muellerian duct regression and virilization in a 46 XX woman N Engl J Med 351 792 798 PMID 15317892 DOI 10 1056 NEJMoa040533 Huguet E L McMahon J A McMahon A P Bicknell R Harris A L 1994 Differential expression of human Wnt genes 2 3 4 and 7B in human breast cell lines and normal and disease states of human breast tissue Cancer Res 54 2615 2621 PMID 8168088PrimitkiZahvoryuvannya genetichno pov yazani z WNT4 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 12783 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ