Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

TRAF2 англ TNF receptor associated factor 2 білок який кодується однойменним геном розташованим у людей на короткому пле

TRAF2

TRAF2

TRAF2 (англ. TNF receptor associated factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми. Довжина поліпептидного ланцюга білка становить 501 амінокислот, а молекулярна маса — 55 859.

TRAF2
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TRAF2, MGC:45012, TRAP, TRAP3, TNF receptor associated factor 2, RNF117
Зовнішні ІД OMIM: 601895 MGI: 101835 HomoloGene: 22520 GeneCards: TRAF2
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
7186
22030
Ensembl
ENSG00000127191
ENSMUSG00000026942
UniProt
Q12933
P39429
RefSeq (мРНК)
NM_021138
NM_009422
NM_001290413
RefSeq (білок)
NP_066961
NP_001277342
NP_033448
Локус (UCSC) Хр. 9: 136.88 – 136.93 Mb Хр. 2: 25.41 – 25.44 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCG
HRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREV
ESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKER
HLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPRE
KFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSS
VLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTY
DGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDG
TGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPD
VTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTG
L

Кодований геном білок за функціями належить до трансфераз, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, убіквітинування білків, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном цинку. Локалізований у цитоплазмі.

Література

  • Song H.Y., Donner D.B. (1995). Association of a RING finger protein with the cytoplasmic domain of the human type-2 tumour necrosis factor receptor. Biochem. J. 309: 825—829. PMID 7639698 DOI:10.1042/bj3090825
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Rothe M., Wong S.C., Henzel W.J., Goeddel D.V. (1994). A novel family of putative signal transducers associated with the cytoplasmic domain of the 75 kDa tumor necrosis factor receptor. Cell. 78: 681—692. PMID 8069916 DOI:10.1016/0092-8674(94)90532-0
  • Lee S.Y., Park C.G., Choi Y. (1996). T cell receptor-dependent cell death of T cell hybridomas mediated by the CD30 cytoplasmic domain in association with tumor necrosis factor receptor-associated factors. J. Exp. Med. 183: 669—674. PMID 8627180 DOI:10.1084/jem.183.2.669
  • Lee S.Y., Lee S.Y., Choi Y. (1997). TRAF-interacting protein (TRIP): a novel component of the tumor necrosis factor receptor (TNFR)- and CD30-TRAF signaling complexes that inhibits TRAF2-mediated NF-kappaB activation. J. Exp. Med. 185: 1275—1285. PMID 9104814 DOI:10.1084/jem.185.7.1275
  • Malinin N.L., Boldin M.P., Kovalenko A.V., Wallach D. (1997). MAP3K-related kinase involved in NF-kappaB induction by TNF, CD95 and IL-1. Nature. 385: 540—544. PMID 9020361 DOI:10.1038/385540a0

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:12032 (англ.) . Процитовано 8 вересня 2017.
  4. (англ.) . Архів оригіналу за 26 серпня 2017. Процитовано 8 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

TRAF2 angl TNF receptor associated factor 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 9 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 501 aminokislot a molekulyarna masa 55 859 TRAF2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3M0D 1CA4 1CA9 1CZY 1CZZ 1D00 1D01 1D0A 1D0J 1F3V 1QSC 3KNV 3M06 3M0AIdentifikatoriSimvoliTRAF2 MGC 45012 TRAP TRAP3 TNF receptor associated factor 2 RNF117Zovnishni ID OMIM 601895 MGI 101835 HomoloGene 22520 GeneCards TRAF2Ontologiya genaMolekulyarna funkciya sphingolipid binding lipid binding CD40 receptor binding mitogen activated protein kinase kinase kinase binding zinc ion binding signal transducer activity zv yazuvannya z ionom metalu GO 0050372 ubiquitin protein transferase activity GO 0001948 GO 0016582 protein binding identical protein binding thioesterase binding enzyme binding protein phosphatase binding protein kinase binding ubiquitin protein ligase binding transferase activity tumor necrosis factor receptor binding GO 0032403 protein containing complex bindingKlitinna komponenta TRAF2 GSTP1 complex AIP1 IRE1 complex ubiquitin ligase complex vesicle membrane cell cortex membrane raft CD40 receptor complex cytoplasmic side of plasma membrane IRE1 TRAF2 ASK1 complex nukleoplazma citoplazma gialoplazma GO 0009327 protein containing complexBiologichnij proces regulation of apoptotic process positive regulation of tumor necrosis factor mediated signaling pathway positive regulation of JUN kinase activity negative regulation of glial cell apoptotic process regulation of tumor necrosis factor mediated signaling pathway protein K63 linked ubiquitination positive regulation of DNA binding transcription factor activity tumor necrosis factor mediated signaling pathway activation of NF kappaB inducing kinase activity positive regulation of protein homodimerization activity response to endoplasmic reticulum stress protein homotrimerization intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress positive regulation of I kappaB phosphorylation regulation of JNK cascade GO 0044257 protein catabolic process positive regulation of NF kappaB transcription factor activity positive regulation of interleukin 2 production death inducing signaling complex assembly positive regulation of T cell cytokine production Ubikvitin zalezhnij proteoliz positive regulation of I kappaB kinase NF kappaB signaling positive regulation of extrinsic apoptotic signaling pathway cellular response to nitric oxide regulation of extrinsic apoptotic signaling pathway via death domain receptors I kappaB kinase NF kappaB signaling activation of cysteine type endopeptidase activity involved in apoptotic process GO 0072468 signalna transdukciya protein autoubiquitination negative regulation of neuron death programmed necrotic cell death GO 0097285 apoptoz negative regulation of extrinsic apoptotic signaling pathway via death domain receptors protein deubiquitination protein heterooligomerization GO 0034622 protein containing complex assemblyDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7186 22030Ensembl ENSG00000127191 ENSMUSG00000026942UniProt Q12933 P39429RefSeq mRNK NM 021138NM 009422 NM 001290413RefSeq bilok NP 066961NP 001277342 NP 033448Lokus UCSC Hr 9 136 88 136 93 MbHr 2 25 41 25 44 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCG HRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREV ESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKER HLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPRE KFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSS VLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTA EACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTY DGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDG TGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPD VTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTG L A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz ubikvitinuvannya bilkiv acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z lipidami ionami metaliv ionom cinku Lokalizovanij u citoplazmi LiteraturaSong H Y Donner D B 1995 Association of a RING finger protein with the cytoplasmic domain of the human type 2 tumour necrosis factor receptor Biochem J 309 825 829 PMID 7639698 DOI 10 1042 bj3090825 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Rothe M Wong S C Henzel W J Goeddel D V 1994 A novel family of putative signal transducers associated with the cytoplasmic domain of the 75 kDa tumor necrosis factor receptor Cell 78 681 692 PMID 8069916 DOI 10 1016 0092 8674 94 90532 0 Lee S Y Park C G Choi Y 1996 T cell receptor dependent cell death of T cell hybridomas mediated by the CD30 cytoplasmic domain in association with tumor necrosis factor receptor associated factors J Exp Med 183 669 674 PMID 8627180 DOI 10 1084 jem 183 2 669 Lee S Y Lee S Y Choi Y 1997 TRAF interacting protein TRIP a novel component of the tumor necrosis factor receptor TNFR and CD30 TRAF signaling complexes that inhibits TRAF2 mediated NF kappaB activation J Exp Med 185 1275 1285 PMID 9104814 DOI 10 1084 jem 185 7 1275 Malinin N L Boldin M P Kovalenko A V Wallach D 1997 MAP3K related kinase involved in NF kappaB induction by TNF CD95 and IL 1 Nature 385 540 544 PMID 9020361 DOI 10 1038 385540a0PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 12032 angl Procitovano 8 veresnya 2017 angl Arhiv originalu za 26 serpnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 9 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ