Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

TP63 англ Tumor protein p63 білок який кодується однойменним геном розташованим у людей на короткому плечі 3 ї хромосоми

TP63

TP63

TP63 (англ. Tumor protein p63) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 680 амінокислот, а молекулярна маса — 76 785.

TP63
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TP63, AIS, B(p51A), B(p51B), EEC3, KET, LMS, NBP, OFC8, RHS, SHFM4, TP53CP, TP53L, TP73L, p40, p51, p53CP, p63, p73H, p73L, tumor protein p63
Зовнішні ІД OMIM: 603273 MGI: 1330810 HomoloGene: 31189 GeneCards: TP63
Пов'язані генетичні захворювання
adenocarcinoma of the lung, lymphoblastic leukemia, рак легень, ADULT syndrome, Limb–mammary syndrome, ankyloblepharon-ectodermal defects-cleft lip/palate syndrome, split hand-foot malformation 2
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
8626
22061
Ensembl
ENSG00000073282
ENSMUSG00000022510
UniProt
Q9H3D4
O88898
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 3: 189.63 – 189.9 Mb Хр. 16: 25.5 – 25.71 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFL
SPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQD
SDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYA
QPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKK
LYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELS
REFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGR
DRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDEL
LYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQ
TSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMG
ANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIV
SFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTI
SFPPRDEWNDFNFDMDARRNKQQRIKEEGE

Кодований геном білок за функціями належить до активаторів, . Задіяний у таких біологічних процесах як апоптоз, транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література

  • Augustin M., Bamberger C., Paul D., Schmale H. (1998). Cloning and chromosomal mapping of the human p53-related KET gene to chromosome 3q27 and its murine homolog Ket to mouse chromosome 16. Mamm. Genome. 9: 899—902. PMID 9799841 DOI:10.1007/s003359900891
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Kim E.-J., Park J.-S., Um S.-J. (2002). Identification and characterization of HIPK2 interacting with p73 and modulating functions of the p53 family in vivo. J. Biol. Chem. 277: 32020—32028. PMID 11925430 DOI:10.1074/jbc.M200153200
  • Zeng S.X., Dai M.-S., Keller D.M., Lu H. (2002). SSRP1 functions as a co-activator of the transcriptional activator p63. EMBO J. 21: 5487—5497. PMID 12374749 DOI:10.1093/emboj/cdf540
  • Li Y., Zhou Z., Chen C. (2008). WW domain-containing E3 ubiquitin protein ligase 1 targets p63 transcription factor for ubiquitin-mediated proteasomal degradation and regulates apoptosis. Cell Death Differ. 15: 1941—1951. PMID 18806757 DOI:10.1038/cdd.2008.134
  • Zheng M.Z., Zheng L.M., Zeng Y.X. (2008). SCC-112 gene is involved in tumor progression and promotes the cell proliferation in G2/M phase. J. Cancer Res. Clin. Oncol. 134: 453—462. PMID 17846787 DOI:10.1007/s00432-007-0306-x

Примітки

  1. Захворювання, генетично пов'язані з TP63 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:15979 (англ.) . Процитовано 30 серпня 2017.
  5. (англ.) . Архів оригіналу за 17 серпня 2017. Процитовано 30 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

TP63 angl Tumor protein p63 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 680 aminokislot a molekulyarna masa 76 785 TP63Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4A9Z 1RG6 2RMN 2Y9T 2Y9U 3QYM 3QYN 3US0 3US1 3US2 3ZY0 3ZY1IdentifikatoriSimvoliTP63 AIS B p51A B p51B EEC3 KET LMS NBP OFC8 RHS SHFM4 TP53CP TP53L TP73L p40 p51 p53CP p63 p73H p73L tumor protein p63Zovnishni ID OMIM 603273 MGI 1330810 HomoloGene 31189 GeneCards TP63Pov yazani genetichni zahvoryuvannyaadenocarcinoma of the lung lymphoblastic leukemia rak legen ADULT syndrome Limb mammary syndrome ankyloblepharon ectodermal defects cleft lip palate syndrome split hand foot malformation 2 Ontologiya genaMolekulyarna funkciya GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific zv yazuvannya z ionom metalu damaged DNA binding GO 0001948 GO 0016582 protein binding WW domain binding double stranded DNA binding DNA binding sequence specific DNA binding identical protein binding chromatin binding p53 binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity MDM2 MDM4 family protein binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific protein domain specific bindingKlitinna komponenta citoplazma neuron projection klitinne yadro rough endoplasmic reticulum transcription regulator complex nukleoplazma dendrit nejrobiologiya mitohondriya kompleks Goldzhi gialoplazma GO 0009327 protein containing complexBiologichnij proces pattern specification process skeletal system development epithelial cell development negative regulation of keratinocyte differentiation epidermal cell division anatomical structure formation involved in morphogenesis prostate gland development transcription by RNA polymerase II squamous basal epithelial stem cell differentiation involved in prostate gland acinus development ectoderm and mesoderm interaction cellular response to DNA damage stimulus female genitalia morphogenesis odontogenesis of dentin containing tooth prostatic bud formation positive regulation of cell cycle G1 S phase transition positive regulation of mesenchymal cell proliferation Spermatogenez multicellular organism aging smooth muscle tissue development positive regulation of fibroblast apoptotic process animal organ morphogenesis hair follicle morphogenesis positive regulation of Notch signaling pathway GO 0097285 apoptoz remodelyuvannya hromatinu GO 0009373 regulation of transcription DNA templated regulation of neuron apoptotic process positive regulation of apoptotic signaling pathway regulation of cysteine type endopeptidase activity involved in apoptotic process transcription DNA templated embryonic limb morphogenesis negative regulation of mesoderm development epidermis development post anal tail morphogenesis response to gamma radiation protein homotetramerization Signalnij shlyah Notch hair follicle development neuron apoptotic process polarized epithelial cell differentiation proximal distal pattern formation diferenciaciya klitin positive regulation of keratinocyte proliferation skin morphogenesis epithelial cell differentiation urinary bladder development cellular response to UV establishment of planar polarity negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II protein tetramerization keratinocyte proliferation positive regulation of osteoblast differentiation regulation of epidermal cell division GO 0045996 negative regulation of transcription DNA templated negative regulation of cellular senescence intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator sympathetic nervous system development establishment of skin barrier morphogenesis of a polarized epithelium keratinocyte differentiation multicellular organism development mitotic G1 DNA damage checkpoint signaling cloacal septation response to X ray GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II DNA damage response signal transduction by p53 class mediator resulting in transcription of p21 class mediator positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway regulation of signal transduction by p53 class mediator regulation of apoptotic process GO 0010260 starinnya lyudini negative regulation of intracellular estrogen receptor signaling pathway GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of somatic stem cell population maintenance proliferaciya epidermal cell differentiation embryonic forelimb morphogenesis embryonic hindlimb morphogenesis skin epidermis development cranial skeletal system development GO 0007571 rozvojovij procesDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez8626 22061Ensembl ENSG00000073282 ENSMUSG00000022510UniProt Q9H3D4 O88898RefSeq mRNK NM 001114978 NM 001114979 NM 001114980 NM 001114981 NM 001114982NM 003722 NM 001329144 NM 001329145 NM 001329146 NM 001329148 NM 001329149 NM 001329150 NM 001329964NM 001127259 NM 001127260 NM 001127261 NM 001127262 NM 001127263NM 001127264 NM 001127265 NM 011641RefSeq bilok NP 001108450 NP 001108451 NP 001108452 NP 001108453 NP 001108454NP 001316073 NP 001316074 NP 001316075 NP 001316077 NP 001316078 NP 001316079 NP 001316893 NP 003713NP 001120731 NP 001120732 NP 001120733 NP 001120734 NP 001120735NP 001120736 NP 001120737 NP 035771Lokus UCSC Hr 3 189 63 189 9 MbHr 16 25 5 25 71 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFL SPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQD SDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYA QPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKK LYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELS REFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGR DRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDEL LYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQ TSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMG ANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIV SFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTI SFPPRDEWNDFNFDMDARRNKQQRIKEEGE A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv Zadiyanij u takih biologichnih procesah yak apoptoz transkripciya regulyaciya transkripciyi alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK Lokalizovanij u yadri LiteraturaAugustin M Bamberger C Paul D Schmale H 1998 Cloning and chromosomal mapping of the human p53 related KET gene to chromosome 3q27 and its murine homolog Ket to mouse chromosome 16 Mamm Genome 9 899 902 PMID 9799841 DOI 10 1007 s003359900891 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kim E J Park J S Um S J 2002 Identification and characterization of HIPK2 interacting with p73 and modulating functions of the p53 family in vivo J Biol Chem 277 32020 32028 PMID 11925430 DOI 10 1074 jbc M200153200 Zeng S X Dai M S Keller D M Lu H 2002 SSRP1 functions as a co activator of the transcriptional activator p63 EMBO J 21 5487 5497 PMID 12374749 DOI 10 1093 emboj cdf540 Li Y Zhou Z Chen C 2008 WW domain containing E3 ubiquitin protein ligase 1 targets p63 transcription factor for ubiquitin mediated proteasomal degradation and regulates apoptosis Cell Death Differ 15 1941 1951 PMID 18806757 DOI 10 1038 cdd 2008 134 Zheng M Z Zheng L M Zeng Y X 2008 SCC 112 gene is involved in tumor progression and promotes the cell proliferation in G2 M phase J Cancer Res Clin Oncol 134 453 462 PMID 17846787 DOI 10 1007 s00432 007 0306 xPrimitkiZahvoryuvannya genetichno pov yazani z TP63 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 15979 angl Procitovano 30 serpnya 2017 angl Arhiv originalu za 17 serpnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 3 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ