Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

TLR4 англ Toll like receptor 4 білок який кодується однойменним геном розташованим у людей на короткому плечі 9 ї хромос

TLR4

TLR4

TLR4 (англ. Toll like receptor 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми. Довжина поліпептидного ланцюга білка становить 839 амінокислот, а молекулярна маса — 95 680.

TLR4
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TLR4, ARMD10, CD284, TLR-4, TOLL, toll like receptor 4
Зовнішні ІД OMIM: 603030 MGI: 96824 HomoloGene: 41317 GeneCards: TLR4
Реагує на сполуку
resatorvid
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
7099
21898
Ensembl
ENSG00000136869
ENSMUSG00000039005
UniProt
O00206
Q9QUK6
RefSeq (мРНК)
NM_138557
NM_003266
NM_138554
NM_138556
NM_021297
RefSeq (білок)
NP_003257
NP_612564
NP_612567
NP_067272
Локус (UCSC) Хр. 9: 117.7 – 117.72 Mb Хр. 4: 66.75 – 66.85 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPD
NLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQS
LSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLK
TLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQ
MPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGL
AGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKL
KSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTS
LKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLI
YLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTF
LDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLD
YSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVL
VYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGV
PPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFE
YEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDS
VLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, запальна відповідь, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

TLR4 здатний активувати NF-κB.

Література

  • Medzhitov R., Preston-Hurlburt P., Janeway C.A. Jr. (1997). A human homologue of the Drosophila Toll protein signals activation of adaptive immunity. Nature. 388: 394—397. PMID 9237759 DOI:10.1038/41131
  • Rock F.L., Hardiman G., Timans J.C., Kastelein R.A., Bazan J.F. (1998). A family of human receptors structurally related to Drosophila Toll. Proc. Natl. Acad. Sci. U.S.A. 95: 588—593. PMID 9435236 DOI:10.1073/pnas.95.2.588
  • Smirnova I., Poltorak A., Chan E.K.L., McBride C., Beutler B. (2000). Phylogenetic variation and polymorphism at the Toll-like receptor 4 locus (TLR4). Genome Biol. 1: RESEARCH002.1—RESEARCH002.10. PMID 11104518 DOI:10.1186/gb-2000-1-1-research002
  • Georgel P., Macquin C., Bahram S. (2009). The heterogeneous allelic repertoire of human Toll-Like receptor (TLR) genes. PLoS ONE. 4: E7803—E7803. PMID 19924287 DOI:10.1371/journal.pone.0007803
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504

Примітки

  1. Сполуки, які фізично взаємодіють з toll like receptor 4 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:11850 (англ.) . Процитовано 8 вересня 2017.
  5. UniProt, O00206 (англ.) . Архів оригіналу за 20 серпня 2013. Процитовано 8 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

TLR4 angl Toll like receptor 4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 9 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 839 aminokislot a molekulyarna masa 95 680 TLR4Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB4G8A 2Z62 2Z63 2Z65 2Z66 3FXI 3UL7 3UL8 3UL9 3ULAIdentifikatoriSimvoliTLR4 ARMD10 CD284 TLR 4 TOLL toll like receptor 4Zovnishni ID OMIM 603030 MGI 96824 HomoloGene 41317 GeneCards TLR4Reaguye na spolukuresatorvidOntologiya genaMolekulyarna funkciya lipopolysaccharide immune receptor activity lipopolysaccharide binding GO 0001948 GO 0016582 protein binding transmembrane signaling receptor activityKlitinna komponenta citoplazma membrana perinuclear region of cytoplasm cell surface integral component of membrane klitinna membrana endosome membrane intrinsic component of plasma membrane integral component of plasma membrane lipopolysaccharide receptor complex external side of plasma membraneBiologichnij proces positive regulation of MHC class II biosynthetic process positive regulation of JNK cascade TRIF dependent toll like receptor signaling pathway cellular response to mechanical stimulus positive regulation of interleukin 8 production positive regulation of ERK1 and ERK2 cascade T helper 1 type immune response positive regulation of platelet activation positive regulation of interleukin 1 production positive regulation of stress activated MAPK cascade positive regulation of NLRP3 inflammasome complex assembly positive regulation of interleukin 12 production positive regulation of interferon alpha production I kappaB phosphorylation positive regulation of nitric oxide synthase biosynthetic process positive regulation of B cell proliferation defense response to bacterium positive regulation of interleukin 6 production activation of innate immune response positive regulation of tumor necrosis factor production negative regulation of tumor necrosis factor production vrodzhenij imunitet negative regulation of interleukin 17 production I kappaB kinase NF kappaB signaling positive regulation of interferon beta production positive regulation of inflammatory response toll like receptor 4 signaling pathway positive regulation of macrophage cytokine production positive regulation of interleukin 10 production proces imunnoyi sistemi astrocyte development intestinal epithelial structure maintenance positive regulation of nucleotide binding oligomerization domain containing 1 signaling pathway response to lipopolysaccharide cellular response to lipoteichoic acid positive regulation of NF kappaB transcription factor activity GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid negative regulation of interleukin 23 production regulation of inflammatory response positive regulation of chemokine production lipopolysaccharide mediated signaling pathway detection of fungus positive regulation of nucleotide binding oligomerization domain containing 2 signaling pathway negative regulation of interferon gamma production response to bacterium negative regulation of osteoclast differentiation B cell proliferation involved in immune response positive regulation of nitric oxide biosynthetic process negative regulation of interleukin 6 production positive regulation of interferon gamma production nitric oxide production involved in inflammatory response MyD88 dependent toll like receptor signaling pathway regulation of dendritic cell cytokine production GO 1901313 positive regulation of gene expression negative regulation of ERK1 and ERK2 cascade positive regulation of I kappaB kinase NF kappaB signaling macrophage activation detection of lipopolysaccharide cellular response to lipopolysaccharide positive regulation of lymphocyte proliferation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II MyD88 independent toll like receptor signaling pathway GO 0072468 signalna transdukciya inflammatory response GO 0051636 defense response to Gram negative bacterium toll like receptor signaling pathway GO 0060554 GO 0060555 Nekroptoz apoptotic signaling pathway negative regulation of MyD88 independent toll like receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7099 21898Ensembl ENSG00000136869 ENSMUSG00000039005UniProt O00206 Q9QUK6RefSeq mRNK NM 138557 NM 003266 NM 138554 NM 138556NM 021297RefSeq bilok NP 003257 NP 612564 NP 612567NP 067272Lokus UCSC Hr 9 117 7 117 72 MbHr 4 66 75 66 85 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSIA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do receptoriv Zadiyanij u takih biologichnih procesah yak imunitet vrodzhenij imunitet zapalna vidpovid alternativnij splajsing Lokalizovanij u klitinnij membrani membrani TLR4 zdatnij aktivuvati NF kB LiteraturaMedzhitov R Preston Hurlburt P Janeway C A Jr 1997 A human homologue of the Drosophila Toll protein signals activation of adaptive immunity Nature 388 394 397 PMID 9237759 DOI 10 1038 41131 Rock F L Hardiman G Timans J C Kastelein R A Bazan J F 1998 A family of human receptors structurally related to Drosophila Toll Proc Natl Acad Sci U S A 95 588 593 PMID 9435236 DOI 10 1073 pnas 95 2 588 Smirnova I Poltorak A Chan E K L McBride C Beutler B 2000 Phylogenetic variation and polymorphism at the Toll like receptor 4 locus TLR4 Genome Biol 1 RESEARCH002 1 RESEARCH002 10 PMID 11104518 DOI 10 1186 gb 2000 1 1 research002 Georgel P Macquin C Bahram S 2009 The heterogeneous allelic repertoire of human Toll Like receptor TLR genes PLoS ONE 4 E7803 E7803 PMID 19924287 DOI 10 1371 journal pone 0007803 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504PrimitkiSpoluki yaki fizichno vzayemodiyut z toll like receptor 4 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 11850 angl Procitovano 8 veresnya 2017 UniProt O00206 angl Arhiv originalu za 20 serpnya 2013 Procitovano 8 veresnya 2017 Div takozhHromosoma 9Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ