TIMP3 (англ. TIMP metallopeptidase inhibitor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми. Довжина поліпептидного ланцюга білка становить 211 амінокислот, а молекулярна маса — 24 145.
TIMP3 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | TIMP3, HSMRK222, K222, K222TA2, SFD, TIMP metallopeptidase inhibitor 3 | ||||||||||||||||
Зовнішні ІД | OMIM: 188826 MGI: 98754 HomoloGene: 36322 GeneCards: TIMP3 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
Sorsby's fundus dystrophy | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 22: 32.8 – 32.86 Mb | Хр. 10: 86.14 – 86.19 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MTPWLGLIVL | LGSWSLGDWG | AEACTCSPSH | PQDAFCNSDI | VIRAKVVGKK | ||||
LVKEGPFGTL | VYTIKQMKMY | RGFTKMPHVQ | YIHTEASESL | CGLKLEVNKY | ||||
QYLLTGRVYD | GKMYTGLCNF | VERWDQLTLS | QRKGLNYRYH | LGCNCKIKSC | ||||
YYLPCFVTSK | NECLWTDMLS | NFGYPGYQSK | HYACIRQKGG | YCSWYRGWAP | ||||
PDKSIINATD | P |
Кодований геном білок за функціями належить до інгібіторів протеаз, . Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у позаклітинному матриксі. Також секретований назовні.
Література
- Silbiger S.M., Jacobsen V.L., Cupples R.L., Koski R.A. (1994). Cloning of cDNAs encoding human TIMP-3, a novel member of the tissue inhibitor of metalloproteinase family. Gene. 141: 293—297. PMID 8163205 DOI:10.1016/0378-1119(94)90588-6
- Stoehr H., Roomp K., Felbor U., Weber B.H.F. (1995). Genomic organization of the human tissue inhibitor of metalloproteinases-3 (TIMP3). Genome Res. 5: 483—487. PMID 8808469 DOI:10.1101/gr.5.5.483
- Ruiz A.C., Brett P., Bok D. (1996). TIMP-3 is expressed in the human retinal pigment epithelium. Biochem. Biophys. Res. Commun. 226: 467—474. PMID 8806658 DOI:10.1006/bbrc.1996.1379
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Apte S.S., Mattei M.-G., Olsen B.R. (1994). Cloning of the cDNA encoding human tissue inhibitor of metalloproteinases-3 (TIMP-3) and mapping of the TIMP3 gene to chromosome 22. Genomics. 19: 86—90. PMID 8188246 DOI:10.1006/geno.1994.1016
- Kishnani N.S., Staskus P.W., Yang T.-T., Masiarz F.R., Hawkes S.P. (1995). Identification and characterization of human tissue inhibitor of metalloproteinase-3 and detection of three additional metalloproteinase inhibitor activities in extracellular matrix. Matrix Biol. 14: 479—488. PMID 7795886 DOI:10.1016/0945-053X(95)90005-5
Примітки
- Захворювання, генетично пов'язані з TIMP3 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:11822 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
TIMP3 angl TIMP metallopeptidase inhibitor 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 22 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 211 aminokislot a molekulyarna masa 24 145 TIMP3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB3CKIIdentifikatoriSimvoliTIMP3 HSMRK222 K222 K222TA2 SFD TIMP metallopeptidase inhibitor 3Zovnishni ID OMIM 188826 MGI 98754 HomoloGene 36322 GeneCards TIMP3Pov yazani genetichni zahvoryuvannyaSorsby s fundus dystrophyOntologiya genaMolekulyarna funkciya peptidase inhibitor activity GO 0048551 enzyme inhibitor activity zv yazuvannya z ionom metalu protease binding GO 0001948 GO 0016582 protein binding metalloendopeptidase inhibitor activityKlitinna komponenta GO 0005578 Pozaklitinna matricya bazalna membrana ekzosoma klitinne yadro extracellular region platelet dense granule lumen mizhklitinnij prostir collagen containing extracellular matrixBiologichnij proces cellular response to organic substance negative regulation of peptidase activity vidpovid na stimul positive regulation of TRAIL activated apoptotic signaling pathway negative regulation of ERK1 and ERK2 cascade negative regulation of membrane protein ectodomain proteolysis zir platelet degranulation response to organic substance negative regulation of metalloendopeptidase activity response to hormone negative regulation of endopeptidase activity response to cytokineDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7078 21859Ensembl ENSG00000100234 ENSMUSG00000020044UniProt P35625 P39876RefSeq mRNK NM 000362NM 011595RefSeq bilok NP 000353NP 035725Lokus UCSC Hr 22 32 8 32 86 MbHr 10 86 14 86 19 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDPA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do ingibitoriv proteaz Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku Lokalizovanij u pozaklitinnomu matriksi Takozh sekretovanij nazovni LiteraturaSilbiger S M Jacobsen V L Cupples R L Koski R A 1994 Cloning of cDNAs encoding human TIMP 3 a novel member of the tissue inhibitor of metalloproteinase family Gene 141 293 297 PMID 8163205 DOI 10 1016 0378 1119 94 90588 6 Stoehr H Roomp K Felbor U Weber B H F 1995 Genomic organization of the human tissue inhibitor of metalloproteinases 3 TIMP3 Genome Res 5 483 487 PMID 8808469 DOI 10 1101 gr 5 5 483 Ruiz A C Brett P Bok D 1996 TIMP 3 is expressed in the human retinal pigment epithelium Biochem Biophys Res Commun 226 467 474 PMID 8806658 DOI 10 1006 bbrc 1996 1379 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Apte S S Mattei M G Olsen B R 1994 Cloning of the cDNA encoding human tissue inhibitor of metalloproteinases 3 TIMP 3 and mapping of the TIMP3 gene to chromosome 22 Genomics 19 86 90 PMID 8188246 DOI 10 1006 geno 1994 1016 Kishnani N S Staskus P W Yang T T Masiarz F R Hawkes S P 1995 Identification and characterization of human tissue inhibitor of metalloproteinase 3 and detection of three additional metalloproteinase inhibitor activities in extracellular matrix Matrix Biol 14 479 488 PMID 7795886 DOI 10 1016 0945 053X 95 90005 5PrimitkiZahvoryuvannya genetichno pov yazani z TIMP3 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 11822 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 23 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 22Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi