TGFB3 (англ. Transforming growth factor beta 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми. Довжина поліпептидного ланцюга білка становить 412 амінокислот, а молекулярна маса — 47 328.
TGFB3 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | TGFB3, ARVD, ARVD1, RNHF, TGF-beta3, Transforming growth factor, beta 3, LDS5, transforming growth factor beta 3, TGF beta 3 | ||||||||||||||||
Зовнішні ІД | OMIM: 190230 MGI: 98727 HomoloGene: 2433 GeneCards: TGFB3 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
Rienhoff syndrome | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 14: 75.96 – 75.98 Mb | Хр. 12: 86.1 – 86.13 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MKMHLQRALV | VLALLNFATV | SLSLSTCTTL | DFGHIKKKRV | EAIRGQILSK | ||||
LRLTSPPEPT | VMTHVPYQVL | ALYNSTRELL | EEMHGEREEG | CTQENTESEY | ||||
YAKEIHKFDM | IQGLAEHNEL | AVCPKGITSK | VFRFNVSSVE | KNRTNLFRAE | ||||
FRVLRVPNPS | SKRNEQRIEL | FQILRPDEHI | AKQRYIGGKN | LPTRGTAEWL | ||||
SFDVTDTVRE | WLLRRESNLG | LEISIHCPCH | TFQPNGDILE | NIHEVMEIKF | ||||
KGVDNEDDHG | RGDLGRLKKQ | KDHHNPHLIL | MMIPPHRLDN | PGQGGQRKKR | ||||
ALDTNYCFRN | LEENCCVRPL | YIDFRQDLGW | KWVHEPKGYY | ANFCSGPCPY | ||||
LRSADTTHST | VLGLYNTLNP | EASASPCCVP | QDLEPLTILY | YVGRTPKVEQ | ||||
LSNMVVKSCK | CS |
Кодований геном білок за функціями належить до факторів росту, мітогенів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Секретований назовні.
Література
- ten Dijke P., Hansen P., Iwata K., Pieler C., Foulkes J.G. (1988). Identification of another member of the transforming growth factor type beta gene family. Proc. Natl. Acad. Sci. U.S.A. 85: 4715—4719. PMID 3164476 DOI:10.1073/pnas.85.13.4715
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Arrick B.A., Lee A.L., Grendell R.L., Derynck R. (1991). Inhibition of translation of transforming growth factor-beta 3 mRNA by its 5' untranslated region. Mol. Cell. Biol. 11: 4306—4313. PMID 1875922 DOI:10.1128/MCB.11.9.4306
Примітки
- Захворювання, генетично пов'язані з TGFB3 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 9 вересня 2017. Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 11 вересня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
TGFB3 angl Transforming growth factor beta 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 412 aminokislot a molekulyarna masa 47 328 TGFB3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1KTZ 1TGJ 1TGK 2PJY 3EO1 4UM9IdentifikatoriSimvoliTGFB3 ARVD ARVD1 RNHF TGF beta3 Transforming growth factor beta 3 LDS5 transforming growth factor beta 3 TGF beta 3Zovnishni ID OMIM 190230 MGI 98727 HomoloGene 2433 GeneCards TGFB3Pov yazani genetichni zahvoryuvannyaRienhoff syndrome Ontologiya genaMolekulyarna funkciya type III transforming growth factor beta receptor binding cytokine activity type I transforming growth factor beta receptor binding GO 0001948 GO 0016582 protein binding protein heterodimerization activity transforming growth factor beta receptor binding growth factor activity transforming growth factor beta binding type II transforming growth factor beta receptor binding identical protein bindingKlitinna komponenta citoplazma GO 0005578 Pozaklitinna matricya T tubule klitinna membrana secretory granule cell surface neuronal cell body platelet alpha granule lumen klitinne yadro extracellular region mizhklitinnij prostir vnutrishnoklitinna membranna organela collagen containing extracellular matrixBiologichnij proces regulation of apoptotic process GO 1904089 negative regulation of neuron apoptotic process positive regulation of collagen biosynthetic process cell cell junction organization regulation of MAPK cascade SMAD protein signal transduction positive regulation of bone mineralization embryonic neurocranium morphogenesis response to progesterone zhinocha vagitnist response to laminar fluid shear stress GO 0010260 starinnya lyudini platelet degranulation in utero embryonic development negative regulation of transforming growth factor beta receptor signaling pathway Zagoyennya ran salivary gland morphogenesis mammary gland development odontogenesis response to estrogen positive regulation of protein secretion ossification involved in bone remodeling uterine wall breakdown frontal suture morphogenesis inner ear development negative regulation of macrophage cytokine production lung alveolus development digestive tract development transforming growth factor beta receptor signaling pathway positive regulation of filopodium assembly positive regulation of cell division face morphogenesis detection of hypoxia GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of SMAD protein signal transduction positive regulation of tight junction disassembly positive regulation of epithelial to mesenchymal transition positive regulation of stress fiber assembly regulation of epithelial to mesenchymal transition involved in endocardial cushion formation positive regulation of apoptotic process response to hypoxia positive regulation of pathway restricted SMAD protein phosphorylation GO 0060469 GO 0009371 positive regulation of transcription DNA templated negative regulation of vascular associated smooth muscle cell proliferation BMP signaling pathway rozvitok klitin regulation of signaling receptor activity positive regulation of cell population proliferation negative regulation of cell population proliferation secondary palate development regulation of cell population proliferationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7043 21809Ensembl ENSG00000119699 ENSMUSG00000021253UniProt P10600 P17125RefSeq mRNK NM 003239 NM 001329938 NM 001329939NM 009368RefSeq bilok NP 001316867 NP 001316868 NP 003230n dLokus UCSC Hr 14 75 96 75 98 MbHr 12 86 1 86 13 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSK LRLTSPPEPTVMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEY YAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAE FRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWL SFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKF KGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPY LRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQ LSNMVVKSCKCS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do faktoriv rostu mitogeniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Sekretovanij nazovni Literaturaten Dijke P Hansen P Iwata K Pieler C Foulkes J G 1988 Identification of another member of the transforming growth factor type beta gene family Proc Natl Acad Sci U S A 85 4715 4719 PMID 3164476 DOI 10 1073 pnas 85 13 4715 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Arrick B A Lee A L Grendell R L Derynck R 1991 Inhibition of translation of transforming growth factor beta 3 mRNA by its 5 untranslated region Mol Cell Biol 11 4306 4313 PMID 1875922 DOI 10 1128 MCB 11 9 4306PrimitkiZahvoryuvannya genetichno pov yazani z TGFB3 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 9 veresnya 2017 Procitovano 11 veresnya 2017 angl Arhiv originalu za 11 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 14 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi