TGFA (англ. Transforming growth factor alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 160 амінокислот, а молекулярна маса — 17 006.
TGFA | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | TGFA, TFGA, transforming growth factor alpha, Transforming growth factor - α | ||||||||||||||||
Зовнішні ІД | OMIM: 190170 MGI: 98724 HomoloGene: 2431 GeneCards: TGFA | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 70.45 – 70.55 Mb | Хр. 6: 86.17 – 86.25 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MVPSAGQLAL | FALGIVLAAC | QALENSTSPL | SADPPVAAAV | VSHFNDCPDS | ||||
HTQFCFHGTC | RFLVQEDKPA | CVCHSGYVGA | RCEHADLLAV | VAASQKKQAI | ||||
TALVVVSIVA | LAVLIITCVL | IHCCQVRKHC | EWCRALICRH | EKPSALLKGR | ||||
TACCHSETVV |
Кодований геном білок за функціями належить до факторів росту, мітогенів. Задіяний у таких біологічних процесах як поліморфізм, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.
Література
- Derynck R., Roberts A.B., Winkler M.E., Chen E.Y., Goeddel D.V. (1984). Human transforming growth factor-alpha: precursor structure and expression in E. coli. Cell. 38: 287—297. PMID 6088071 DOI:10.1016/0092-8674(84)90550-6
- Jakowlew S.B., Kondaiah P., Dillard P.J., Sporn M.B., Roberts A.B. (1988). A novel low molecular weight ribonucleic acid (RNA) related to transforming growth factor alpha messenger RNA. Mol. Endocrinol. 2: 1056—1063. PMID 2464748 DOI:10.1210/mend-2-11-1056
- Qian J.F., Lazar-Wesley E., Breugnot C., May E. (1993). Human transforming growth factor alpha: sequence analysis of the 4.5-kb and 1.6-kb mRNA species. Gene. 132: 291—296. PMID 8224876 DOI:10.1016/0378-1119(93)90210-T
- Xu X., Liao J., Creek K.E., Pirisi L. (1999). Human keratinocytes and tumor-derived cell lines express alternatively spliced forms of transforming growth factor-alpha mRNA, encoding precursors lacking carboxyl-terminal valine residues. Oncogene. 18: 5554—5562. PMID 10523832 DOI:10.1038/sj.onc.1203091
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Jakobovits E.B., Schlokat U., Vannice J.L., Derynck R., Levinson A.D. (1988). The human transforming growth factor alpha promoter directs transcription initiation from a single site in the absence of a TATA sequence. Mol. Cell. Biol. 8: 5549—5554. PMID 2907605 DOI:10.1128/MCB.8.12.5549
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 28 травня 2017. Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 25 вересня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
TGFA angl Transforming growth factor alpha bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 160 aminokislot a molekulyarna masa 17 006 TGFANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1GK5 1MOX 1YUF 1YUG 2TGF 3E50 3TGF 4TGFIdentifikatoriSimvoliTGFA TFGA transforming growth factor alpha Transforming growth factor aZovnishni ID OMIM 190170 MGI 98724 HomoloGene 2431 GeneCards TGFAOntologiya genaMolekulyarna funkciya epidermal growth factor receptor binding GO 0001948 GO 0016582 protein binding growth factor activityKlitinna komponenta integral component of membrane endoplasmic reticulum membrane membrana klitinna membrana integral component of plasma membrane extracellular region cell surface basolateral plasma membrane perinuclear region of cytoplasm ER to Golgi transport vesicle membrane endoplasmic reticulum Golgi intermediate compartment membrane GO 0016023 cytoplasmic vesicle Golgi membrane mizhklitinnij prostir clathrin coated vesicle membraneBiologichnij proces positive regulation of epidermal growth factor activated receptor activity positive regulation of epithelial cell proliferation endoplasmic reticulum to Golgi vesicle mediated transport COPII vesicle coating proliferaciya positive regulation of mitotic nuclear division positive regulation of cell division GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II epidermal growth factor receptor signaling pathway positive regulation of cell population proliferation MAPK cascade GO 0072468 signalna transdukciya negative regulation of epidermal growth factor receptor signaling pathway positive regulation of protein kinase B signaling membrane organization GO 0007243 intracellular signal transductionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7039 21802Ensembl ENSG00000163235 ENSMUSG00000029999UniProt P01135 P48030RefSeq mRNK NM 001099691 NM 001308158 NM 001308159 NM 003236NM 031199RefSeq bilok NP 001093161 NP 001295087 NP 001295088 NP 003227NP 112476 NP 001390047Lokus UCSC Hr 2 70 45 70 55 MbHr 6 86 17 86 25 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDS HTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAI TALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGR TACCHSETVV A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do faktoriv rostu mitogeniv Zadiyanij u takih biologichnih procesah yak polimorfizm alternativnij splajsing Lokalizovanij u klitinnij membrani membrani Takozh sekretovanij nazovni LiteraturaDerynck R Roberts A B Winkler M E Chen E Y Goeddel D V 1984 Human transforming growth factor alpha precursor structure and expression in E coli Cell 38 287 297 PMID 6088071 DOI 10 1016 0092 8674 84 90550 6 Jakowlew S B Kondaiah P Dillard P J Sporn M B Roberts A B 1988 A novel low molecular weight ribonucleic acid RNA related to transforming growth factor alpha messenger RNA Mol Endocrinol 2 1056 1063 PMID 2464748 DOI 10 1210 mend 2 11 1056 Qian J F Lazar Wesley E Breugnot C May E 1993 Human transforming growth factor alpha sequence analysis of the 4 5 kb and 1 6 kb mRNA species Gene 132 291 296 PMID 8224876 DOI 10 1016 0378 1119 93 90210 T Xu X Liao J Creek K E Pirisi L 1999 Human keratinocytes and tumor derived cell lines express alternatively spliced forms of transforming growth factor alpha mRNA encoding precursors lacking carboxyl terminal valine residues Oncogene 18 5554 5562 PMID 10523832 DOI 10 1038 sj onc 1203091 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Jakobovits E B Schlokat U Vannice J L Derynck R Levinson A D 1988 The human transforming growth factor alpha promoter directs transcription initiation from a single site in the absence of a TATA sequence Mol Cell Biol 8 5549 5554 PMID 2907605 DOI 10 1128 MCB 8 12 5549PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 28 travnya 2017 Procitovano 28 serpnya 2017 angl Arhiv originalu za 25 veresnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij