Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
SUMO2 (англ. Small ubiquitin-like modifier 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 95 амінокислот, а молекулярна маса — 10 871.
| SUMO2 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | SUMO2, HSMT3, SMT3B, SMT3H2, SUMO3, Smt3A, small ubiquitin-like modifier 2, small ubiquitin like modifier 2 | ||||||||||||||||
| Зовнішні ІД | OMIM: 603042 MGI: 2158813 HomoloGene: 87858 GeneCards: SUMO2 | ||||||||||||||||
| |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 17: 75.17 – 75.18 Mb | Хр. 11: 115.41 – 115.43 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MADEKPKEGV | KTENNDHINL | KVAGQDGSVV | QFKIKRHTPL | SKLMKAYCER | ||||
| QGLSMRQIRF | RFDGQPINET | DTPAQLEMED | EDTIDVFQQQ | TGGVY |
Задіяний у таких біологічних процесах, як убіквітинування білків, ацетилювання, альтернативний сплайсинг. Локалізований у ядрі.
Література
- Mannen H., Tseng H.M., Cho C.L., Li S.S.-L. (1996). Cloning and expression of human homolog HSMT3 to yeast SMT3 suppressor of MIF2 mutations in a centromere protein gene. Biochem. Biophys. Res. Commun. 222: 178—180. PMID 8630065 DOI:10.1006/bbrc.1996.0717
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Kamitani T., Kito K., Nguyen H.P., Fukuda-Kamitani T., Yeh E.T.H. (1998). Characterization of a second member of the sentrin family of ubiquitin-like proteins. J. Biol. Chem. 273: 11349—11353. PMID 9556629 DOI:10.1074/jbc.273.18.11349
- Saitoh H., Hinchey J. (2000). Functional heterogeneity of small ubiquitin-related protein modifiers SUMO-1 versus SUMO-2/3. J. Biol. Chem. 275: 6252—6258. PMID 10692421 DOI:10.1074/jbc.275.9.6252
- Su H.-L., Li S.S.-L. (2002). Molecular features of human ubiquitin-like SUMO genes and their encoded proteins. Gene. 296: 65—73. PMID 12383504 DOI:10.1016/S0378-1119(02)00843-0
- Reverter D., Lima C.D. (2004). A basis for SUMO protease specificity provided by analysis of human Senp2 and a Senp2-SUMO complex. Structure. 12: 1519—1531. PMID 15296745 DOI:10.1016/j.str.2004.05.023
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 21 вересня 2017. Процитовано 12 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
SUMO2 angl Small ubiquitin like modifier 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 95 aminokislot a molekulyarna masa 10 871 SUMO2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1WM2 1WM3 1WZ0 2AWT 2CKH 2D07 2IO0 2IO3 2IYD 2RPQ 3UIN 3UIO 3ZO5 4BKG 4NPN 2N9E 5D2M 2N1WIdentifikatoriSimvoliSUMO2 HSMT3 SMT3B SMT3H2 SUMO3 Smt3A small ubiquitin like modifier 2 small ubiquitin like modifier 2Zovnishni ID OMIM 603042 MGI 2158813 HomoloGene 87858 GeneCards SUMO2Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding ubiquitin protein ligase binding protein tag RNA binding transcription corepressor binding SUMO transferase activity ubiquitin like protein ligase bindingKlitinna komponenta PML body klitinne yadro nukleoplazmaBiologichnij proces global genome nucleotide excision repair positive regulation of proteasomal ubiquitin dependent protein catabolic process protein sumoylation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase IIDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez6613 170930Ensembl ENSG00000188612 ENSMUSG00000020738UniProt P61956 P61957RefSeq mRNK NM 001005849 NM 006937NM 133354RefSeq bilok NP 001005849 NP 008868NP 579932Lokus UCSC Hr 17 75 17 75 18 MbHr 11 115 41 115 43 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCER QGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Zadiyanij u takih biologichnih procesah yak ubikvitinuvannya bilkiv acetilyuvannya alternativnij splajsing Lokalizovanij u yadri LiteraturaMannen H Tseng H M Cho C L Li S S L 1996 Cloning and expression of human homolog HSMT3 to yeast SMT3 suppressor of MIF2 mutations in a centromere protein gene Biochem Biophys Res Commun 222 178 180 PMID 8630065 DOI 10 1006 bbrc 1996 0717 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kamitani T Kito K Nguyen H P Fukuda Kamitani T Yeh E T H 1998 Characterization of a second member of the sentrin family of ubiquitin like proteins J Biol Chem 273 11349 11353 PMID 9556629 DOI 10 1074 jbc 273 18 11349 Saitoh H Hinchey J 2000 Functional heterogeneity of small ubiquitin related protein modifiers SUMO 1 versus SUMO 2 3 J Biol Chem 275 6252 6258 PMID 10692421 DOI 10 1074 jbc 275 9 6252 Su H L Li S S L 2002 Molecular features of human ubiquitin like SUMO genes and their encoded proteins Gene 296 65 73 PMID 12383504 DOI 10 1016 S0378 1119 02 00843 0 Reverter D Lima C D 2004 A basis for SUMO protease specificity provided by analysis of human Senp2 and a Senp2 SUMO complex Structure 12 1519 1531 PMID 15296745 DOI 10 1016 j str 2004 05 023PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 23 veresnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 21 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 17 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi