Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
RLN2 (англ. Relaxin 2) – білок, який кодується однойменним геном, розташованим у людей на 9-й хромосомі. Довжина поліпептидного ланцюга білка становить 185 амінокислот, а молекулярна маса — 21 043.
| RLN2 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | RLN2, H2, H2-RLX, RLXH2, bA12D24.1.1, bA12D24.1.2, relaxin 2 | ||||||||||||||||
| Зовнішні ІД | OMIM: 179740 MGI: 97931 HomoloGene: 129864 GeneCards: RLN2 | ||||||||||||||||
| |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 9: 5.3 – 5.3 Mb | Хр. 19: 29.31 – 29.31 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MPRLFFFHLL | GVCLLLNQFS | RAVADSWMEE | VIKLCGRELV | RAQIAICGMS | ||||
| TWSKRSLSQE | DAPQTPRPVA | EIVPSFINKD | TETINMMSEF | VANLPQELKL | ||||
| TLSEMQPALP | QLQQHVPVLK | DSSLLFEEFK | KLIRNRQSEA | ADSSPSELKY | ||||
| LGLDTHSRKK | RQLYSALANK | CCHVGCTKRS | LARFC |
Кодований геном білок за функцією належить до гормонів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Секретований назовні.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Gunnersen J.M., Fu P., Roche P.J., Tregear G.W. (1996). Expression of human relaxin genes: characterization of a novel alternatively-spliced human relaxin mRNA species. Mol. Cell. Endocrinol. 118: 85—94. PMID 8735594 DOI:10.1016/0303-7207(96)03770-7
- Garibay-Tupas J.L., Csiszar K., Fox M., Povey S., Bryant-Greenwood G.D. (1999). Analysis of the 5'-upstream regions of the human relaxin H1 and H2 genes and their chromosomal localization on chromosome 9p24.1 by radiation hybrid and breakpoint mapping. J. Mol. Endocrinol. 23: 355—365. PMID 10601981 DOI:10.1677/jme.0.0230355
- Winslow J.W., Griffin P.R., Rinderknecht E., Vandlen R.L. (1990). Structural characterization by mass spectrometry of native and recombinant human relaxin. Biomed. Environ. Mass Spectrom. 19: 655—664. PMID 2076464 DOI:10.1002/bms.1200191105
- Buellesbach E.E., Schwabe C. (1991). Total synthesis of human relaxin and human relaxin derivatives by solid-phase peptide synthesis and site-directed chain combination. J. Biol. Chem. 266: 10754—10761. PMID 2040595
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10027 (англ.) . Процитовано 19 вересня 2017.
{{}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url () - UniProt, P04090 (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 19 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
RLN2 angl Relaxin 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na 9 j hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 185 aminokislot a molekulyarna masa 21 043 4 RLN2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2MV1 6RLXIdentifikatoriSimvoliRLN2 H2 H2 RLX RLXH2 bA12D24 1 1 bA12D24 1 2 relaxin 2Zovnishni ID OMIM 179740 MGI 97931 HomoloGene 129864 GeneCards RLN2Ontologiya genaMolekulyarna funkciya hormone activityKlitinna komponenta extracellular regionBiologichnij proces zhinocha vagitnist GO 1901313 positive regulation of gene expression positive regulation of angiogenesis GO 0048552 regulation of catalytic activity regulation of signaling receptor activity G protein coupled receptor signaling pathwayDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez6019 19773Ensembl ENSG00000107014 ENSMUSG00000039097UniProt P04090 P47932RefSeq mRNK NM 005059 NM 134441 NM 001329191NM 011272RefSeq bilok NP 001316120 NP 005050 NP 604390NP 035402Lokus UCSC Hr 9 5 3 5 3 MbHr 19 29 31 29 31 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMS TWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKL TLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKY LGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do gormoniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Sekretovanij nazovni Literaturared The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Gunnersen J M Fu P Roche P J Tregear G W 1996 Expression of human relaxin genes characterization of a novel alternatively spliced human relaxin mRNA species Mol Cell Endocrinol 118 85 94 PMID 8735594 DOI 10 1016 0303 7207 96 03770 7 Garibay Tupas J L Csiszar K Fox M Povey S Bryant Greenwood G D 1999 Analysis of the 5 upstream regions of the human relaxin H1 and H2 genes and their chromosomal localization on chromosome 9p24 1 by radiation hybrid and breakpoint mapping J Mol Endocrinol 23 355 365 PMID 10601981 DOI 10 1677 jme 0 0230355 Winslow J W Griffin P R Rinderknecht E Vandlen R L 1990 Structural characterization by mass spectrometry of native and recombinant human relaxin Biomed Environ Mass Spectrom 19 655 664 PMID 2076464 DOI 10 1002 bms 1200191105 Buellesbach E E Schwabe C 1991 Total synthesis of human relaxin and human relaxin derivatives by solid phase peptide synthesis and site directed chain combination J Biol Chem 266 10754 10761 PMID 2040595Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10027 angl Procitovano 19 veresnya 2017 a href wiki D0 A8 D0 B0 D0 B1 D0 BB D0 BE D0 BD Cite web title Shablon Cite web cite web a Obslugovuvannya CS1 Storinki z parametrom url status ale bez parametra archive url posilannya UniProt P04090 angl Arhiv originalu za 8 serpnya 2017 Procitovano 19 veresnya 2017 Div takozhred Hromosoma 9 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij Otrimano z https uk wikipedia org w index php title RLN2 amp oldid 43447155