RIPK1 (англ. Receptor interacting serine/threonine kinase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 671 амінокислот, а молекулярна маса — 75 931.
RIPK1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | RIPK1, RIP, RIP1, RIP-1, receptor interacting serine/threonine kinase 1, IMD57, AIEFL | ||||||||||||||||
Зовнішні ІД | OMIM: 603453 MGI: 108212 HomoloGene: 2820 GeneCards: RIPK1 | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
Viroporin 3a | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 6: 3.06 – 3.12 Mb | Хр. 13: 34.19 – 34.22 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MQPDMSLNVI | KMKSSDFLES | AELDSGGFGK | VSLCFHRTQG | LMIMKTVYKG | ||||
PNCIEHNEAL | LEEAKMMNRL | RHSRVVKLLG | VIIEEGKYSL | VMEYMEKGNL | ||||
MHVLKAEMST | PLSVKGRIIL | EIIEGMCYLH | GKGVIHKDLK | PENILVDNDF | ||||
HIKIADLGLA | SFKMWSKLNN | EEHNELREVD | GTAKKNGGTL | YYMAPEHLND | ||||
VNAKPTEKSD | VYSFAVVLWA | IFANKEPYEN | AICEQQLIMC | IKSGNRPDVD | ||||
DITEYCPREI | ISLMKLCWEA | NPEARPTFPG | IEEKFRPFYL | SQLEESVEED | ||||
VKSLKKEYSN | ENAVVKRMQS | LQLDCVAVPS | SRSNSATEQP | GSLHSSQGLG | ||||
MGPVEESWFA | PSLEHPQEEN | EPSLQSKLQD | EANYHLYGSR | MDRQTKQQPR | ||||
QNVAYNREEE | RRRRVSHDPF | AQQRPYENFQ | NTEGKGTAYS | SAASHGNAVH | ||||
QPSGLTSQPQ | VLYQNNGLYS | SHGFGTRPLD | PGTAGPRVWY | RPIPSHMPSL | ||||
HNIPVPETNY | LGNTPTMPFS | SLPPTDESIK | YTIYNSTGIQ | IGAYNYMEIG | ||||
GTSSSLLDST | NTNFKEEPAA | KYQAIFDNTT | SLTDKHLDPI | RENLGKHWKN | ||||
CARKLGFTQS | QIDEIDHDYE | RDGLKEKVYQ | MLQKWVMREG | IKGATVGKLA | ||||
QALHQCSRID | LLSSLIYVSQ | N |
Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у клітинній мембрані, цитоплазмі, мембрані.
Література
- Hsu H., Huang J., Shu H.-B., Baichwal V.R., Goeddel D.V. (1996). TNF-dependent recruitment of the protein kinase RIP to the TNF receptor-1 signaling complex. Immunity. 4: 387—396. PMID 8612133 DOI:10.1016/S1074-7613(00)80252-6
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Stanger B.Z., Leder P., Lee T.-H., Kim E., Seed B. (1995). RIP: a novel protein containing a death domain that interacts with Fas/APO-1 (CD95) in yeast and causes cell death. Cell. 81: 513—523. PMID 7538908 DOI:10.1016/0092-8674(95)90072-1
- Lin Y., Devin A., Rodriguez Y., Liu Z.-G. (1999). Cleavage of the death domain kinase RIP by caspase-8 prompts TNF-induced apoptosis. Genes Dev. 13: 2514—2526. PMID 10521396 DOI:10.1101/gad.13.19.2514
- Sanz L., Sanchez P., Lallena M.-J., Diaz-Meco M.T., Moscat J. (1999). The interaction of p62 with RIP links the atypical PKCs to NF-kappaB activation. EMBO J. 18: 3044—3053. PMID 10356400 DOI:10.1093/emboj/18.11.3044
- Chen D., Li X., Zhai Z., Shu H.-B. (2002). A novel zinc finger protein interacts with receptor-interacting protein (RIP) and inhibits tumor necrosis factor (TNF)- and IL1-induced NF-kappa B activation. J. Biol. Chem. 277: 15985—15991. PMID 11854271 DOI:10.1074/jbc.M108675200
Примітки
- Сполуки, які фізично взаємодіють з Receptor interacting serine/threonine kinase 1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10019 (англ.) . Процитовано 6 вересня 2017.
- (англ.) . Архів оригіналу за 13 вересня 2017. Процитовано 6 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
RIPK1 angl Receptor interacting serine threonine kinase 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 671 aminokislot a molekulyarna masa 75 931 RIPK1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4ITH 4ITI 4ITJ 4NEU 5HX6IdentifikatoriSimvoliRIPK1 RIP RIP1 RIP 1 receptor interacting serine threonine kinase 1 IMD57 AIEFLZovnishni ID OMIM 603453 MGI 108212 HomoloGene 2820 GeneCards RIPK1Reaguye na spolukuViroporin 3a Ontologiya genaMolekulyarna funkciya transferase activity protein kinase activity nucleotide binding death domain binding kinase activity protein serine threonine kinase activity GO 0001948 GO 0016582 protein binding identical protein binding ATP binding ubiquitin protein ligase binding signal transducer activity GO 0032403 protein containing complex binding death receptor binding JUN kinase kinase kinase activityKlitinna komponenta membrana receptor complex klitinna membrana mitohondriya death inducing signaling complex membrane raft citoplazma gialoplazma endosome membrane ripoptosome GO 0009327 protein containing complexBiologichnij proces T cell apoptotic process positive regulation of protein phosphorylation amyloid fibril formation positive regulation of cell death fosforilyuvannya regulation of ATP ADP antiporter activity peptidyl serine autophosphorylation regulation of tumor necrosis factor mediated signaling pathway positive regulation of macrophage differentiation cellular response to tumor necrosis factor cellular response to growth factor stimulus negative regulation of extrinsic apoptotic signaling pathway positive regulation of programmed cell death tumor necrosis factor mediated signaling pathway positive regulation of JNK cascade GO 1904489 regulation of reactive oxygen species metabolic process negative regulation of I kappaB kinase NF kappaB signaling TRIF dependent toll like receptor signaling pathway response to tumor necrosis factor positive regulation of necroptotic process protein phosphorylation positive regulation of reactive oxygen species metabolic process death inducing signaling complex assembly positive regulation of NF kappaB transcription factor activity necroptotic signaling pathway positive regulation of interleukin 8 production positive regulation of tumor necrosis factor production positive regulation of apoptotic process positive regulation of I kappaB kinase NF kappaB signaling positive regulation of extrinsic apoptotic signaling pathway protein autophosphorylation regulation of extrinsic apoptotic signaling pathway via death domain receptors GO 0060554 GO 0060555 Nekroptoz positive regulation of phosphorylation negative regulation of extrinsic apoptotic signaling pathway in absence of ligand I kappaB kinase NF kappaB signaling activation of cysteine type endopeptidase activity involved in apoptotic process protein homooligomerization GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II ripoptosome assembly GO 0072468 signalna transdukciya positive regulation of MAPK cascade positive regulation of hydrogen peroxide induced cell death apoptotic signaling pathway GO 0097285 apoptoz GO 0010703 GO 0010702 zaprogramovana klitinna smert extrinsic apoptotic signaling pathway positive regulation of necrotic cell death negative regulation of extrinsic apoptotic signaling pathway via death domain receptors protein deubiquitination ripoptosome assembly involved in necroptotic process MyD88 independent toll like receptor signaling pathway toll like receptor 3 signaling pathway GO 0022415 viral process protein heterooligomerization MAPK cascade negative regulation of cardiac muscle cell proliferation cellular response to hydrogen peroxide programmed necrotic cell death positive regulation of tumor necrosis factor mediated signaling pathway positive regulation of production of miRNAs involved in gene silencing by miRNA GO 1990376 negative regulation of G1 S transition of mitotic cell cycleDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez8737 19766Ensembl ENSG00000137275 ENSMUSG00000021408UniProt Q13546 Q60855RefSeq mRNK NM 003804 NM 001317061 NM 001354930 NM 001354931 NM 001354932NM 001354933 NM 001354934NM 009068 NM 001359997RefSeq bilok NP 001303990 NP 003795 NP 001341859 NP 001341860 NP 001341861NP 001341862 NP 001341863NP 033094 NP 001346926Lokus UCSC Hr 6 3 06 3 12 MbHr 13 34 19 34 22 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKG PNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNL MHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDF HIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLND VNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVD DITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLG MGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPR QNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVH QPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSL HNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIG GTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLA QALHQCSRIDLLSSLIYVSQN A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz serin treoninovih proteyinkinaz fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami Lokalizovanij u klitinnij membrani citoplazmi membrani LiteraturaHsu H Huang J Shu H B Baichwal V R Goeddel D V 1996 TNF dependent recruitment of the protein kinase RIP to the TNF receptor 1 signaling complex Immunity 4 387 396 PMID 8612133 DOI 10 1016 S1074 7613 00 80252 6 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Stanger B Z Leder P Lee T H Kim E Seed B 1995 RIP a novel protein containing a death domain that interacts with Fas APO 1 CD95 in yeast and causes cell death Cell 81 513 523 PMID 7538908 DOI 10 1016 0092 8674 95 90072 1 Lin Y Devin A Rodriguez Y Liu Z G 1999 Cleavage of the death domain kinase RIP by caspase 8 prompts TNF induced apoptosis Genes Dev 13 2514 2526 PMID 10521396 DOI 10 1101 gad 13 19 2514 Sanz L Sanchez P Lallena M J Diaz Meco M T Moscat J 1999 The interaction of p62 with RIP links the atypical PKCs to NF kappaB activation EMBO J 18 3044 3053 PMID 10356400 DOI 10 1093 emboj 18 11 3044 Chen D Li X Zhai Z Shu H B 2002 A novel zinc finger protein interacts with receptor interacting protein RIP and inhibits tumor necrosis factor TNF and IL1 induced NF kappa B activation J Biol Chem 277 15985 15991 PMID 11854271 DOI 10 1074 jbc M108675200PrimitkiSpoluki yaki fizichno vzayemodiyut z Receptor interacting serine threonine kinase 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10019 angl Procitovano 6 veresnya 2017 angl Arhiv originalu za 13 veresnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi