Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

RHOA англ Ras homolog family member A білок який кодується однойменним геном розташованим у людей на короткому плечі 3 ї

RHOA

RHOA

RHOA (англ. Ras homolog family member A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 193 амінокислот, а молекулярна маса — 21 768.

RHOA
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RHOA, ARH12, ARHA, RHO12, RHOH12, ras homolog family member A, EDFAOB
Зовнішні ІД OMIM: 165390 MGI: 1096342 HomoloGene: 68986 GeneCards: RHOA
Реагує на сполуку
Viroporin 3a
Viroporin 3a
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
387
11848
Ensembl
ENSG00000067560
ENSMUSG00000007815
UniProt
P61586
Q9QUI0
RefSeq (мРНК)
NM_016802
NM_001313961
NM_001313962
RefSeq (білок)
NP_001300890
NP_001300891
NP_058082
Локус (UCSC) Хр. 3: 49.36 – 49.41 Mb Хр. 9: 108.18 – 108.22 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG
KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT
PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR
IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, клітинний цикл, поділ клітини. Білок має сайт для зв'язування з нуклеотидами, ГТФ, іоном магнію. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних відростках.

Література

  • Yeramian P., Chardin P., Madaule P., Tavitian A. (1987). Nucleotide sequence of human rho cDNA clone 12. Nucleic Acids Res. 15: 1869—1869. PMID 3822842 DOI:10.1093/nar/15.4.1869
  • Fagan K.P., Oliveira L., Pittler S.J. (1994). Sequence of rho small GTP-binding protein cDNAs from human retina and identification of novel 5' end cloning artifacts. Exp. Eye Res. 59: 235—237. PMID 7835413 DOI:10.1006/exer.1994.1102
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Moscow J.A., He R., Gudas J.M., Cowan K.H. (1994). Utilization of multiple polyadenylation signals in the human RHOA protooncogene. Gene. 144: 229—236. PMID 8039707 DOI:10.1016/0378-1119(94)90382-4
  • Vincent S., Settleman J. (1997). The PRK2 kinase is a potential effector target of both Rho and Rac GTPases and regulates actin cytoskeletal organization. Mol. Cell. Biol. 17: 2247—2256. PMID 9121475 DOI:10.1128/MCB.17.4.2247
  • Cachero T.G., Morielli A.D., Peralta E.G. (1998). The small GTP-binding protein RhoA regulates a delayed rectifier potassium channel. Cell. 93: 1077—1085. PMID 9635436 DOI:10.1016/S0092-8674(00)81212-X

Примітки

  1. Сполуки, які фізично взаємодіють з Ras homolog gene family, member A, isoform CRA_a переглянути/редагувати посилання на ВікіДаних.
  2. Сполуки, які фізично взаємодіють з Ras homolog family member A переглянути/редагувати посилання на ВікіДаних.
  3. Human PubMed Reference:.
  4. Mouse PubMed Reference:.
  5. (англ.) . Архів оригіналу за 14 жовтня 2017. Процитовано 27 лютого 2017.
  6. (англ.) . Архів оригіналу за 11 березня 2017. Процитовано 27 лютого 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

RHOA angl Ras homolog family member A bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 193 aminokislot a molekulyarna masa 21 768 RHOANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB5BWM 1A2B 1CC0 1CXZ 1DPF 1FTN 1KMQ 1LB1 1OW3 1S1C 1TX4 1X86 1XCG 2RGN 3KZ1 3LW8 3LWN 3LXR 3MSX 3T06 4D0N 4XH9 4XSG 4XSH 4XOI 5A0F 5FR2 5FR1 5JCP 5C2K 5C4M 5HPYIdentifikatoriSimvoliRHOA ARH12 ARHA RHO12 RHOH12 ras homolog family member A EDFAOBZovnishni ID OMIM 165390 MGI 1096342 HomoloGene 68986 GeneCards RHOAReaguye na spolukuViroporin 3a Viroporin 3a Ontologiya genaMolekulyarna funkciya nucleotide binding myosin binding GTP binding GO 0001948 GO 0016582 protein binding GO 0006184 GTPase activity GDP binding protein kinase binding protein domain specific binding Rho GDP dissociation inhibitor bindingKlitinna komponenta citoplazma vezikula gialoplazma endosoma cell projection endoplasmic reticulum membrane membrana focal adhesion extrinsic component of cytoplasmic side of plasma membrane klitinna membrana mizhklitinni kontakti cell cortex midbody Borozna rozsheplennya citoskelet apical junction complex ekzosoma cell periphery lamellipodium secretory granule membrane ficolin 1 rich granule membrane klitinne yadro akson cell division site ruffle membrane dendritic spine vnutrishnoklitinna membranna organela postsynapse glutamatergic synapse vnutrishnoklitinnijBiologichnij proces actin cytoskeleton reorganization ossification involved in bone maturation apolipoprotein A I mediated signaling pathway regulation of cell migration negative chemotaxis regulation of actin cytoskeleton organization cleavage furrow formation substantia nigra development ephrin receptor signaling pathway endothelial tube lumen extension Roundabout signaling pathway positive regulation of axonogenesis stress fiber assembly positive regulation of lipase activity regulation of osteoblast proliferation podil klitini positive regulation of cytokinesis platelet activation negative regulation of cell migration involved in sprouting angiogenesis positive regulation of protein serine threonine kinase activity mitotic cleavage furrow formation mitotic spindle assembly negative regulation of axonogenesis vascular endothelial growth factor receptor signaling pathway skeletal muscle satellite cell migration trabecula morphogenesis positive regulation of neuron differentiation Rho protein signal transduction positive regulation of I kappaB kinase NF kappaB signaling klitinnij cikl GO 0022415 viral process regulation of small GTPase mediated signal transduction transforming growth factor beta receptor signaling pathway cell migration apical junction assembly wound healing spreading of cells endothelial cell migration positive regulation of stress fiber assembly actin cytoskeleton organization phosphatidylinositol mediated signaling small GTPase mediated signal transduction regulation of cell motility Wnt signaling pathway planar cell polarity pathway protein deubiquitination neutrophil degranulation GO 0000767 cell morphogenesis response to hypoxia angiotensin mediated vasoconstriction involved in regulation of systemic arterial blood pressure alpha beta T cell lineage commitment regulation of systemic arterial blood pressure by endothelin GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II cytoskeleton organization actin filament organization adgeziya klitin cell matrix adhesion G protein coupled receptor signaling pathway skeletal muscle tissue development regulation of actin polymerization or depolymerization regulation of cell shape response to mechanical stimulus response to glucose negative regulation of cell substrate adhesion regulation of neuron projection development negative regulation of neuron projection development cerebral cortex cell migration forebrain radial glial cell differentiation diferenciaciya klitin positive regulation of cell growth positive regulation of cell migration androgen receptor signaling pathway positive regulation of actin filament polymerization establishment or maintenance of actin cytoskeleton polarity stress activated protein kinase signaling cascade negative regulation of intracellular steroid hormone receptor signaling pathway cell junction assembly odontogenesis negative regulation of I kappaB kinase NF kappaB signaling response to amino acid positive regulation of cysteine type endopeptidase activity involved in apoptotic process beta selection GO 1904089 negative regulation of neuron apoptotic process positive regulation of neuron apoptotic process establishment of epithelial cell apical basal polarity response to ethanol negative regulation of neuron differentiation positive regulation of translation positive regulation of cell adhesion negative regulation of cell size positive regulation of vasoconstriction positive regulation of smooth muscle contraction GTP metabolic process positive regulation of alpha beta T cell differentiation neuron projection morphogenesis regulation of dendrite development actin filament bundle assembly response to glucocorticoid regulation of focal adhesion assembly regulation of calcium ion transport negative regulation of cell death regulation of microtubule cytoskeleton organization cellular response to lipopolysaccharide cellular response to cytokine stimulus positive regulation of podosome assembly negative regulation of oxidative phosphorylation positive regulation of NIK NF kappaB signaling negative regulation of reactive oxygen species biosynthetic process positive regulation of vascular associated smooth muscle contraction positive regulation of leukocyte adhesion to vascular endothelial cell regulation of modification of synaptic structure regulation of modification of postsynaptic actin cytoskeleton cellular response to chemokine regulation of neural precursor cell proliferation positive regulation of T cell migrationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez387 11848Ensembl ENSG00000067560 ENSMUSG00000007815UniProt P61586 Q9QUI0RefSeq mRNK NM 001313941 NM 001313943 NM 001313944 NM 001313945 NM 001313946NM 001313947 NM 001664NM 016802 NM 001313961 NM 001313962RefSeq bilok NP 001300870 NP 001300872 NP 001300873 NP 001300874 NP 001300875NP 001300876 NP 001655 NP 001300870 1 NP 001655 1NP 001300890 NP 001300891 NP 058082Lokus UCSC Hr 3 49 36 49 41 MbHr 9 108 18 108 22 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDG KQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWT PEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANR IGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak vzayemodiya hazyayin virus klitinnij cikl podil klitini Bilok maye sajt dlya zv yazuvannya z nukleotidami GTF ionom magniyu Lokalizovanij u klitinnij membrani citoplazmi citoskeleti membrani klitinnih vidrostkah LiteraturaYeramian P Chardin P Madaule P Tavitian A 1987 Nucleotide sequence of human rho cDNA clone 12 Nucleic Acids Res 15 1869 1869 PMID 3822842 DOI 10 1093 nar 15 4 1869 Fagan K P Oliveira L Pittler S J 1994 Sequence of rho small GTP binding protein cDNAs from human retina and identification of novel 5 end cloning artifacts Exp Eye Res 59 235 237 PMID 7835413 DOI 10 1006 exer 1994 1102 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Moscow J A He R Gudas J M Cowan K H 1994 Utilization of multiple polyadenylation signals in the human RHOA protooncogene Gene 144 229 236 PMID 8039707 DOI 10 1016 0378 1119 94 90382 4 Vincent S Settleman J 1997 The PRK2 kinase is a potential effector target of both Rho and Rac GTPases and regulates actin cytoskeletal organization Mol Cell Biol 17 2247 2256 PMID 9121475 DOI 10 1128 MCB 17 4 2247 Cachero T G Morielli A D Peralta E G 1998 The small GTP binding protein RhoA regulates a delayed rectifier potassium channel Cell 93 1077 1085 PMID 9635436 DOI 10 1016 S0092 8674 00 81212 XPrimitkiSpoluki yaki fizichno vzayemodiyut z Ras homolog gene family member A isoform CRA a pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Ras homolog family member A pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 14 zhovtnya 2017 Procitovano 27 lyutogo 2017 angl Arhiv originalu za 11 bereznya 2017 Procitovano 27 lyutogo 2017 Div takozhHromosoma 3 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ