Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

RELA англ RELA proto oncogene NF kB subunit білок який кодується однойменним геном розташованим у людей на короткому пле

RELA

RELA

RELA (англ. RELA proto-oncogene, NF-kB subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 551 амінокислот, а молекулярна маса — 60 219.

RELA
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RELA, NFKB3, p65, RELA proto-oncogene, NF-kB subunit, CMCU
Зовнішні ІД OMIM: 164014 MGI: 103290 HomoloGene: 32064 GeneCards: RELA
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
5970
19697
Ensembl
ENSG00000173039
ENSMUSG00000024927
UniProt
Q04206
Q04207
RefSeq (мРНК)
NM_001145138
NM_001243984
NM_001243985
NM_021975
NM_009045
NM_001365067
RefSeq (білок)
NP_001138610
NP_001230913
NP_001230914
NP_068810
NP_033071
NP_001351996
Локус (UCSC) Хр. 11: 65.65 – 65.66 Mb Хр. 19: 5.69 – 5.7 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGER
STDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFY
EAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRG
DYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVN
RNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAI
VFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYP
FTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMV
SALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDL
GALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAI
TRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS
S

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література

  • Deloukas P., van Loon A.P.G.M. (1993). Genomic organization of the gene encoding the p65 subunit of NF-kappa B: multiple variants of the p65 protein may be generated by alternative splicing. Hum. Mol. Genet. 2: 1895—1900. PMID 8281153 DOI:10.1093/hmg/2.11.1895
  • Lyle R., Valleley E.M., Sharpe P.T., Hewitt J.E. (1994). An alternatively spliced transcript, p65 delta 2, of the gene encoding the p65 subunit of the transcription factor NF-kappa B. Gene. 138: 265—266. PMID 7907305 DOI:10.1016/0378-1119(94)90823-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Ruben S.M., Narayanan R., Klement J.F., Chen C.-H., Rosen C.A. (1992). Functional characterization of the NF-kappa B p65 transcriptional activator and an alternatively spliced derivative. Mol. Cell. Biol. 12: 444—454. PMID 1732726 DOI:10.1128/MCB.12.2.444
  • Ganchi P.A., Sun S.C., Greene W.C., Ballard D.W. (1992). I kappa B/MAD-3 masks the nuclear localization signal of NF-kappa B p65 and requires the transactivation domain to inhibit NF-kappa B p65 DNA binding. Mol. Biol. Cell. 3: 1339—1352. PMID 1493333 DOI:10.1091/mbc.3.12.1339
  • Li Z., Nabel G.J. (1997). A new member of the IkappaB protein family, IkappaB epsilon, inhibits RelA (p65)-mediated NF-kappaB transcription. Mol. Cell. Biol. 17: 6184—6190. PMID 9315679 DOI:10.1128/MCB.17.10.6184

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 16 березня 2016. Процитовано 8 вересня 2017.
  4. (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 8 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

RELA angl RELA proto oncogene NF kB subunit bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 551 aminokislot a molekulyarna masa 60 219 RELANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4KV4 1NFI 2LSP 2O61 3GUT 3QXY 3RC0 4KV1 2N22IdentifikatoriSimvoliRELA NFKB3 p65 RELA proto oncogene NF kB subunit CMCUZovnishni ID OMIM 164014 MGI 103290 HomoloGene 32064 GeneCards RELAOntologiya genaMolekulyarna funkciya protein N terminus binding ankyrin repeat binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific histone deacetylase binding enzyme binding phosphate ion binding GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding protein homodimerization activity chromatin binding NF kappaB binding GO 0001948 GO 0016582 protein binding protein kinase binding DNA binding sequence specific DNA binding actinin binding protein heterodimerization activity transcription factor activity RNA polymerase II distal enhancer sequence specific binding chromatin DNA binding ubiquitin protein ligase binding GO 0000983 RNA polymerase II general transcription initiation factor activity RNA polymerase II transcription regulatory region sequence specific DNA binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific identical protein binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific transcription factor binding GO 0032403 protein containing complex bindingKlitinna komponenta citoplazma gialoplazma I kappaB NF kappaB complex transcription regulator complex NF kappaB complex nukleoplazma klitinne yadro yaderce NF kappaB p50 p65 complex GO 0009327 protein containing complex sinaps glutamatergic synapseBiologichnij proces response to amino acid response to interleukin 1 cellular response to interleukin 6 response to progesterone response to organic substance Fc epsilon receptor signaling pathway GO 1903105 negative regulation of insulin receptor signaling pathway defense response to virus positive regulation of chondrocyte differentiation animal organ morphogenesis response to muscle stretch response to cytokine GO 1903363 negative regulation of protein catabolic process cytokine mediated signaling pathway negative regulation of extrinsic apoptotic signaling pathway response to mechanical stimulus response to muramyl dipeptide stimulatory C type lectin receptor signaling pathway transcription DNA templated response to insulin negative regulation of NIK NF kappaB signaling nucleotide binding oligomerization domain containing 2 signaling pathway membrane protein intracellular domain proteolysis inflammatory response GO 0022415 viral process response to cobalamin hair follicle development positive regulation of miRNA metabolic process acetaldehyde metabolic process cellular response to hepatocyte growth factor stimulus cellular response to nicotine negative regulation of apoptotic process cellular defense response response to morphine response to lipopolysaccharide cellular response to interleukin 1 response to inorganic substance regulation of inflammatory response response to cAMP GO 0045996 negative regulation of transcription DNA templated response to hydrogen peroxide positive regulation of Schwann cell differentiation defense response response to bacterium GO 1904578 response to organic cyclic compound GO 0010260 starinnya lyudini positive regulation of cell population proliferation positive regulation of I kappaB kinase NF kappaB signaling liver development response to UV B T cell receptor signaling pathway cellular response to lipopolysaccharide positive regulation of type I interferon production GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II cellular response to hydrogen peroxide GO 0009373 regulation of transcription DNA templated tumor necrosis factor mediated signaling pathway GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of T cell receptor signaling pathway positive regulation of NF kappaB transcription factor activity cellular response to peptidoglycan cellular response to tumor necrosis factor regulation of NIK NF kappaB signaling positive regulation of NIK NF kappaB signaling GO 0007329 positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus positive regulation of pri miRNA transcription by RNA polymerase II regulation of DNA templated transcription in response to stress cellular response to lipoteichoic acid GO 1901227 negative regulation of transcription by RNA polymerase II negative regulation of protein sumoylation pri miRNA transcription by RNA polymerase II cellular response to angiotensin interleukin 1 mediated signaling pathway cellular response to vascular endothelial growth factor stimulus negative regulation of pri miRNA transcription by RNA polymerase II postsynapse to nucleus signaling pathway GO 0031497 GO 0006336 GO 0034724 GO 0001301 GO 0007580 GO 0034652 GO 0010847 chromatin organization I kappaB kinase NF kappaB signaling NIK NF kappaB signaling positive regulation of leukocyte adhesion to vascular endothelial cellDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5970 19697Ensembl ENSG00000173039 ENSMUSG00000024927UniProt Q04206 Q04207RefSeq mRNK NM 001145138 NM 001243984 NM 001243985 NM 021975NM 009045 NM 001365067RefSeq bilok NP 001138610 NP 001230913 NP 001230914 NP 068810NP 033071 NP 001351996Lokus UCSC Hr 11 65 65 65 66 MbHr 19 5 69 5 7 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGER STDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFY EAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRG DYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVN RNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAI VFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYP FTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMV SALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDL GALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAI TRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQIS S A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak vzayemodiya hazyayin virus transkripciya regulyaciya transkripciyi acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u citoplazmi yadri LiteraturaDeloukas P van Loon A P G M 1993 Genomic organization of the gene encoding the p65 subunit of NF kappa B multiple variants of the p65 protein may be generated by alternative splicing Hum Mol Genet 2 1895 1900 PMID 8281153 DOI 10 1093 hmg 2 11 1895 Lyle R Valleley E M Sharpe P T Hewitt J E 1994 An alternatively spliced transcript p65 delta 2 of the gene encoding the p65 subunit of the transcription factor NF kappa B Gene 138 265 266 PMID 7907305 DOI 10 1016 0378 1119 94 90823 0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Ruben S M Narayanan R Klement J F Chen C H Rosen C A 1992 Functional characterization of the NF kappa B p65 transcriptional activator and an alternatively spliced derivative Mol Cell Biol 12 444 454 PMID 1732726 DOI 10 1128 MCB 12 2 444 Ganchi P A Sun S C Greene W C Ballard D W 1992 I kappa B MAD 3 masks the nuclear localization signal of NF kappa B p65 and requires the transactivation domain to inhibit NF kappa B p65 DNA binding Mol Biol Cell 3 1339 1352 PMID 1493333 DOI 10 1091 mbc 3 12 1339 Li Z Nabel G J 1997 A new member of the IkappaB protein family IkappaB epsilon inhibits RelA p65 mediated NF kappaB transcription Mol Cell Biol 17 6184 6190 PMID 9315679 DOI 10 1128 MCB 17 10 6184PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 16 bereznya 2016 Procitovano 8 veresnya 2017 angl Arhiv originalu za 17 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ