RARB (англ. Retinoic acid receptor beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 455 амінокислот, а молекулярна маса — 50 489.
RARB | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | RARB, HAP, MCOPS12, NR1B2, RRB2, RARbeta1, retinoic acid receptor beta, RARbeta | ||||||||||||||||
Зовнішні ІД | OMIM: 180220 MGI: 97857 HomoloGene: 68100 GeneCards: RARB | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
morbid obesity, syndromic microphthalmia | |||||||||||||||||
Реагує на сполуку | |||||||||||||||||
adapalene, alitretinoin, tamibarotene, tazarotene, третиноїн | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 3: 24.69 – 25.6 Mb | Хр. 14: 5.65 – 6.04 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MTTSGHACPV | PAVNGHMTHY | PATPYPLLFP | PVIGGLSLPP | LHGLHGHPPP | ||||
SGCSTPSPAT | IETQSTSSEE | LVPSPPSPLP | PPRVYKPCFV | CQDKSSGYHY | ||||
GVSACEGCKG | FFRRSIQKNM | IYTCHRDKNC | VINKVTRNRC | QYCRLQKCFE | ||||
VGMSKESVRN | DRNKKKKETS | KQECTESYEM | TAELDDLTEK | IRKAHQETFP | ||||
SLCQLGKYTT | NSSADHRVRL | DLGLWDKFSE | LATKCIIKIV | EFAKRLPGFT | ||||
GLTIADQITL | LKAACLDILI | LRICTRYTPE | QDTMTFSDGL | TLNRTQMHNA | ||||
GFGPLTDLVF | TFANQLLPLE | MDDTETGLLS | AICLICGDRQ | DLEEPTKVDK | ||||
LQEPLLEALK | IYIRKRRPSK | PHMFPKILMK | ITDLRSISAK | GAERVITLKM | ||||
EIPGSMPPLI | QEMLENSEGH | EPLTPSSSGN | TAEHSPSISP | SSVENSGVSQ | ||||
SPLVQ |
Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.
Література
- Benbrook D., Lernherdt E., Pfahl M. (1988). A new retinoic acid receptor identified from a hepatocellular carcinoma. Nature. 333: 669—672. PMID 2836738 DOI:10.1038/333669a0
- de The H., Marchio A., Tiollais P., Dejean A. (1987). A novel steroid thyroid hormone receptor-related gene inappropriately expressed in human hepatocellular carcinoma. Nature. 330: 667—670. PMID 2825037 DOI:10.1038/330667a0
- Sommer K.M., Chen L.I., Treuting P.M., Smith L.T., Swisshelm K. (1999). Elevated retinoic acid receptor beta(4) protein in human breast tumor cells with nuclear and cytoplasmic localization. Proc. Natl. Acad. Sci. U.S.A. 96: 8651—8656. PMID 10411930 DOI:10.1073/pnas.96.15.8651
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Shen S., Kruyt F.A., den Hertog J., van der Saag P.T., Kruijer W. (1991). Mouse and human retinoic acid receptor beta 2 promoters: sequence comparison and localization of retinoic acid responsiveness. DNA Seq. 2: 111—119. PMID 1663808 DOI:10.3109/10425179109039679
- Dejean A., Bougueleret L., Grzeschik K.-H., Tiollais P. (1986). Hepatitis B virus DNA integration in a sequence homologous to v-erb-A and steroid receptor genes in a hepatocellular carcinoma. Nature. 322: 70—72. PMID 3014347 DOI:10.1038/322070a0
Примітки
- Захворювання, генетично пов'язані з RARB переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з Retinoic acid receptor beta переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:9865 (англ.) . Процитовано 30 серпня 2017.
- (англ.) . Архів оригіналу за 22 серпня 2017. Процитовано 30 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
RARB angl Retinoic acid receptor beta bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 455 aminokislot a molekulyarna masa 50 489 RARBNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1HRA 1XAP 4DM6 4DM8 4JYG 4JYH 4JYIIdentifikatoriSimvoliRARB HAP MCOPS12 NR1B2 RRB2 RARbeta1 retinoic acid receptor beta RARbetaZovnishni ID OMIM 180220 MGI 97857 HomoloGene 68100 GeneCards RARBPov yazani genetichni zahvoryuvannyamorbid obesity syndromic microphthalmia Reaguye na spolukuadapalene alitretinoin tamibarotene tazarotene tretinoyin Ontologiya genaMolekulyarna funkciya DNA binding sequence specific DNA binding RNA polymerase II transcription regulatory region sequence specific DNA binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity zinc ion binding zv yazuvannya z ionom metalu steroid hormone receptor activity GO 0001948 GO 0016582 protein binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific GO 0032403 protein containing complex binding retinoid X receptor binding GO 0000975 transcription cis regulatory region binding transcription factor binding nuclear receptor coactivator activity signaling receptor activity GO 0038050 GO 0004886 GO 0038051 nuclear receptor activityKlitinna komponenta citoplazma nukleoplazma klitinne yadro RNA polymerase II transcription regulator complexBiologichnij proces growth plate cartilage development GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II Nejrogenez ureteric bud development GO 0009373 regulation of transcription DNA templated negative regulation of cartilage development multicellular organism growth embryonic eye morphogenesis positive regulation of programmed cell death negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II retinal pigment epithelium development transcription DNA templated outflow tract septum morphogenesis negative regulation of chondrocyte differentiation retinoic acid receptor signaling pathway regulation of myelination retina development in camera type eye positive regulation of neuron differentiation positive regulation of cell population proliferation positive regulation of apoptotic process ventricular cardiac muscle cell differentiation transcription initiation from RNA polymerase II promoter bone development embryonic digestive tract development striatum development GO 0072468 signalna transdukciya negative regulation of cell population proliferation glandular epithelial cell development steroid hormone mediated signaling pathway embryonic hindlimb morphogenesis liver development multicellular organism development hormone mediated signaling pathway diferenciaciya klitin response to retinoic acid response to lipid gland development bone morphogenesis epithelium development cellular response to retinoic acidDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5915 218772Ensembl ENSG00000077092 ENSMUSG00000017491UniProt P10826 Q5QHG3 P22605RefSeq mRNK NM 000965 NM 001290216 NM 001290217 NM 001290266 NM 001290276NM 001290277 NM 001290300 NM 016152NM 001289760 NM 001289761 NM 001289762 NM 011243RefSeq bilok NP 000956 NP 001277145 NP 001277146 NP 001277195 NP 001277205NP 001277206 NP 001277229 NP 057236 NP 001277146 1 NP 001277205 1 NP 057236 1NP 001276689 NP 001276690 NP 001276691 NP 035373Lokus UCSC Hr 3 24 69 25 6 MbHr 14 5 65 6 04 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPP SGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHY GVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFE VGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFP SLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFT GLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDK LQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKM EIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQ SPLVQ A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi polimorfizm alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK Lokalizovanij u citoplazmi yadri LiteraturaBenbrook D Lernherdt E Pfahl M 1988 A new retinoic acid receptor identified from a hepatocellular carcinoma Nature 333 669 672 PMID 2836738 DOI 10 1038 333669a0 de The H Marchio A Tiollais P Dejean A 1987 A novel steroid thyroid hormone receptor related gene inappropriately expressed in human hepatocellular carcinoma Nature 330 667 670 PMID 2825037 DOI 10 1038 330667a0 Sommer K M Chen L I Treuting P M Smith L T Swisshelm K 1999 Elevated retinoic acid receptor beta 4 protein in human breast tumor cells with nuclear and cytoplasmic localization Proc Natl Acad Sci U S A 96 8651 8656 PMID 10411930 DOI 10 1073 pnas 96 15 8651 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Shen S Kruyt F A den Hertog J van der Saag P T Kruijer W 1991 Mouse and human retinoic acid receptor beta 2 promoters sequence comparison and localization of retinoic acid responsiveness DNA Seq 2 111 119 PMID 1663808 DOI 10 3109 10425179109039679 Dejean A Bougueleret L Grzeschik K H Tiollais P 1986 Hepatitis B virus DNA integration in a sequence homologous to v erb A and steroid receptor genes in a hepatocellular carcinoma Nature 322 70 72 PMID 3014347 DOI 10 1038 322070a0PrimitkiZahvoryuvannya genetichno pov yazani z RARB pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Retinoic acid receptor beta pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9865 angl Procitovano 30 serpnya 2017 angl Arhiv originalu za 22 serpnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 3 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi