Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
RARA (англ. Retinoic acid receptor alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 462 амінокислот, а молекулярна маса — 50 771.
| RARA | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | RARA, NR1B1, RAR, retinoic acid receptor alpha, RARalpha | ||||||||||||||||
| Зовнішні ІД | OMIM: 180240 MGI: 97856 HomoloGene: 20262 GeneCards: RARA | ||||||||||||||||
| Реагує на сполуку | |||||||||||||||||
| adapalene, alitretinoin, tamibarotene, tazarotene, третиноїн | |||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
   | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 17: 40.31 – 40.36 Mb | Хр. 11: 98.82 – 98.87 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MASNSSSCPT | PGGGHLNGYP | VPPYAFFFPP | MLGGLSPPGA | LTTLQHQLPV | ||||
| SGYSTPSPAT | IETQSSSSEE | IVPSPPSPPP | LPRIYKPCFV | CQDKSSGYHY | ||||
| GVSACEGCKG | FFRRSIQKNM | VYTCHRDKNC | IINKVTRNRC | QYCRLQKCFE | ||||
| VGMSKESVRN | DRNKKKKEVP | KPECSESYTL | TPEVGELIEK | VRKAHQETFP | ||||
| ALCQLGKYTT | NNSSEQRVSL | DIDLWDKFSE | LSTKCIIKTV | EFAKQLPGFT | ||||
| TLTIADQITL | LKAACLDILI | LRICTRYTPE | QDTMTFSDGL | TLNRTQMHNA | ||||
| GFGPLTDLVF | AFANQLLPLE | MDDAETGLLS | AICLICGDRQ | DLEQPDRVDM | ||||
| LQEPLLEALK | VYVRKRRPSR | PHMFPKMLMK | ITDLRSISAK | GAERVITLKM | ||||
| EIPGSMPPLI | QEMLENSEGL | DTLSGQPGGG | GRDGGGLAPP | PGSCSPSLSP | ||||
| SSNRSSPATH | SP |
Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.
Література
- Giguere V., Ong E.S., Segui P., Evans R.M. (1987). Identification of a receptor for the morphogen retinoic acid. Nature. 330: 624—629. PMID 2825036 DOI:10.1038/330624a0
- Hjalt T.A.H., Murray J.C. (1999). Genomic structure of the human retinoic acid receptor-alpha1 gene. Mamm. Genome. 10: 528—529. PMID 10337631 DOI:10.1007/s003359901036
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Brand N.J., Petkovich M., Chambon P. (1990). Characterization of a functional promoter for the human retinoic acid receptor-alpha (hRAR-alpha). Nucleic Acids Res. 18: 6799—6806. PMID 2175878 DOI:10.1093/nar/18.23.6799
- Petkovich M., Brand N.J., Krust A., Chambon P. (1987). A human retinoic acid receptor which belongs to the family of nuclear receptors. Nature. 330: 444—450. PMID 2825025 DOI:10.1038/330444a0
- Shao W., Halachmi S., Brown M. (2002). ERAP140, a conserved tissue-specific nuclear receptor coactivator. Mol. Cell. Biol. 22: 3358—3372. PMID 11971969 DOI:10.1128/MCB.22.10.3358-3372.2002
Примітки
- Сполуки, які фізично взаємодіють з retinoic acid receptor alpha переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:9864 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 27 вересня 2017. Процитовано 12 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
RARA angl Retinoic acid receptor alpha bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 462 aminokislot a molekulyarna masa 50 771 RARANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1DKF 1DSZ 3A9E 3KMR 3KMZ 4DQM 5K13IdentifikatoriSimvoliRARA NR1B1 RAR retinoic acid receptor alpha RARalphaZovnishni ID OMIM 180240 MGI 97856 HomoloGene 20262 GeneCards RARAReaguye na spolukuadapalene alitretinoin tamibarotene tazarotene tretinoyin Ontologiya genaMolekulyarna funkciya retinoic acid binding GO 0001106 transcription corepressor activity protein domain specific binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0038050 GO 0004886 GO 0038051 nuclear receptor activity mRNA 5 UTR binding signaling receptor binding RNA polymerase II transcription regulatory region sequence specific DNA binding retinoic acid responsive element binding transcription factor binding zv yazuvannya z ionom metalu steroid hormone receptor activity enzyme binding zinc ion binding GO 0001948 GO 0016582 protein binding DNA binding sequence specific DNA binding GO 0001105 transcription coactivator activity protein kinase A binding protein kinase B binding translation repressor activity mRNA regulatory element binding alpha actinin binding protein heterodimerization activity chromatin DNA binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific histone deacetylase binding GO 0000975 transcription cis regulatory region binding nuclear receptor coactivator activity signaling receptor activityKlitinna komponenta citoplazma actin cytoskeleton perinuclear region of cytoplasm neuron projection klitinne yadro cell surface nukleoplazma neuronal cell body dendrit nejrobiologiya gialoplazma RNA polymerase II transcription regulator complexBiologichnij proces growth plate cartilage development germ cell development cellular response to retinoic acid ureteric bud development positive regulation of interleukin 5 production prostate gland development limb development apoptotic cell clearance chondroblast differentiation regulation of granulocyte differentiation protein phosphorylation response to vitamin A face development Spermatogenez response to ethanol negative regulation of cell population proliferation steroid hormone mediated signaling pathway regulation of apoptotic process response to cytokine negative regulation of translation GO 0009373 regulation of transcription DNA templated negative regulation of cell differentiation negative regulation of gene expression transcription DNA templated cellular response to estrogen stimulus GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of cell cycle regulation of myelination positive regulation of neuron differentiation negative regulation of tumor necrosis factor production transcription initiation from RNA polymerase II promoter trachea cartilage development glandular epithelial cell development male gonad development negative regulation of cartilage development response to retinoic acid negative regulation of granulocyte differentiation multicellular organism growth zhinocha vagitnist negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II positive regulation of interleukin 4 production regulation of synaptic plasticity outflow tract septum morphogenesis GO 0045996 negative regulation of transcription DNA templated negative regulation of interferon gamma production response to estradiol negative regulation of translational initiation embryonic camera type eye development positive regulation of interleukin 13 production neural tube closure positive regulation of binding retinoic acid receptor signaling pathway GO 1901313 positive regulation of gene expression Sertoli cell fate commitment positive regulation of cell population proliferation positive regulation of T helper 2 cell differentiation ventricular cardiac muscle cell differentiation liver development cellular response to lipopolysaccharide bone development hippocampus development GO 0072468 signalna transdukciya GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II multicellular organism development hormone mediated signaling pathway diferenciaciya klitin response to lipid gland development bone morphogenesis epithelium developmentDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5914 19401Ensembl ENSG00000131759 ENSMUSG00000037992UniProt P10276 Q6I9R7 P11416RefSeq mRNK NM 000964 NM 001024809 NM 001033603 NM 001145301 NM 001145302NM 001176528 NM 001177302 NM 001177303 NM 009024 NM 001361954RefSeq bilok NP 000955 NP 001019980 NP 001138773 NP 001138774 NP 000955 1NP 001138773 1NP 001169999 NP 001170773 NP 001170774 NP 033050 NP 001348883Lokus UCSC Hr 17 40 31 40 36 MbHr 11 98 82 98 87 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPV SGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHY GVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFE VGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFP ALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFT TLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDM LQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKM EIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSP SSNRSSPATHSP A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK Lokalizovanij u citoplazmi yadri LiteraturaGiguere V Ong E S Segui P Evans R M 1987 Identification of a receptor for the morphogen retinoic acid Nature 330 624 629 PMID 2825036 DOI 10 1038 330624a0 Hjalt T A H Murray J C 1999 Genomic structure of the human retinoic acid receptor alpha1 gene Mamm Genome 10 528 529 PMID 10337631 DOI 10 1007 s003359901036 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Brand N J Petkovich M Chambon P 1990 Characterization of a functional promoter for the human retinoic acid receptor alpha hRAR alpha Nucleic Acids Res 18 6799 6806 PMID 2175878 DOI 10 1093 nar 18 23 6799 Petkovich M Brand N J Krust A Chambon P 1987 A human retinoic acid receptor which belongs to the family of nuclear receptors Nature 330 444 450 PMID 2825025 DOI 10 1038 330444a0 Shao W Halachmi S Brown M 2002 ERAP140 a conserved tissue specific nuclear receptor coactivator Mol Cell Biol 22 3358 3372 PMID 11971969 DOI 10 1128 MCB 22 10 3358 3372 2002PrimitkiSpoluki yaki fizichno vzayemodiyut z retinoic acid receptor alpha pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9864 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 27 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 17 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi