Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

RAC1 англ Ras related C3 botulinum toxin substrate 1 rho family small GTP binding protein Rac1 білок який кодується одно

RAC1

RAC1

RAC1 (англ. Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми. Довжина поліпептидного ланцюга білка становить 192 амінокислот, а молекулярна маса — 21 450.

RAC1
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RAC1, MIG5, Rac-1, TC-25, p21-Rac1, ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1), Rac family small GTPase 1, MRD48
Зовнішні ІД OMIM: 602048 MGI: 97845 HomoloGene: 69035 GeneCards: RAC1
Пов'язані генетичні захворювання
autosomal dominant mental retardation 48
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
5879
19353
Ensembl
ENSG00000136238
ENSMUSG00000001847
UniProt
P63000
P63001
RefSeq (мРНК)
NM_198829
NM_006908
NM_018890
NM_009007
NM_001347530
RefSeq (білок)
NP_008839
NP_061485
NP_001334459
NP_033033
Локус (UCSC) Хр. 7: 6.37 – 6.4 Mb Хр. 5: 143.49 – 143.51 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP
VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE
VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG
AVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з нуклеотидами, ГТФ. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

Література

  • Drivas G.T., Shih A., Coutavas E., Rush M.G., D'Eustachio P. (1990). Characterization of four novel ras-like genes expressed in a human teratocarcinoma cell line. Mol. Cell. Biol. 10: 1793—1798. PMID 2108320 DOI:10.1128/MCB.10.4.1793
  • Jordan P., Brazao R., Boavida M.G., Gespach C., Chastre E. (1999). Cloning of a novel human Rac1b splice variant with increased expression in colorectal tumors. Oncogene. 18: 6835—6839. PMID 10597294 DOI:10.1038/sj.onc.1203233
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Ridley A.J., Paterson H.F., Johnston C.L., Diekmann D., Hall A. (1992). The small GTP-binding protein rac regulates growth factor-induced membrane ruffling. Cell. 70: 401—410. PMID 1643658 DOI:10.1016/0092-8674(92)90164-8
  • Vincent S., Settleman J. (1997). The PRK2 kinase is a potential effector target of both Rho and Rac GTPases and regulates actin cytoskeletal organization. Mol. Cell. Biol. 17: 2247—2256. PMID 9121475 DOI:10.1128/MCB.17.4.2247
  • Ren Y., Li R., Zheng Y., Busch H. (1998). Cloning and characterization of GEF-H1, a microtubule-associated guanine nucleotide exchange factor for Rac and Rho GTPases. J. Biol. Chem. 273: 34954—34960. PMID 9857026 DOI:10.1074/jbc.273.52.34954

Примітки

  1. Захворювання, генетично пов'язані з RAC1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:9801 (англ.) . Процитовано 7 вересня 2017.
  5. (англ.) . Архів оригіналу за 6 вересня 2017. Процитовано 7 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.
На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до .

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

RAC1 angl Ras related C3 botulinum toxin substrate 1 rho family small GTP binding protein Rac1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 7 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 192 aminokislot a molekulyarna masa 21 450 RAC1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1E96 1FOE 1G4U 1HE1 1HH4 1I4D 1I4L 1I4T 1MH1 1RYF 1RYH 2FJU 2H7V 2NZ8 2P2L 2RMK 2VRW 2WKP 2WKQ 2WKR 2YIN 3B13 3BJI 3RYT 3SBD 3SBE 3SU8 3SUA 3TH5 4GZL 4GZM 4YON 5FI0IdentifikatoriSimvoliRAC1 MIG5 Rac 1 TC 25 p21 Rac1 ras related C3 botulinum toxin substrate 1 rho family small GTP binding protein Rac1 Rac family small GTPase 1 MRD48Zovnishni ID OMIM 602048 MGI 97845 HomoloGene 69035 GeneCards RAC1Pov yazani genetichni zahvoryuvannyaautosomal dominant mental retardation 48 Ontologiya genaMolekulyarna funkciya histone deacetylase binding Rho GDP dissociation inhibitor binding GTP dependent protein binding GO 0006184 GTPase activity enzyme binding GO 0001948 GO 0016582 protein binding thioesterase binding protein kinase binding nucleotide binding GTP binding protein serine threonine kinase activity GO 0032403 protein containing complex binding phosphatidylinositol 4 5 bisphosphate 3 kinase activity ATPase bindingKlitinna komponenta citoplazma gialoplazma membrana focal adhesion Melanosoma ruffle membrane trans Golgi network klitinne yadro cell projection extrinsic component of plasma membrane ekzosoma lamellipodium early endosome membrane klitinna membrana mikrofilament cytoplasmic ribonucleoprotein granule endoplasmic reticulum membrane Golgi membrane phagocytic cup GO 0016023 cytoplasmic vesicle GO 0005578 Pozaklitinna matricya secretory granule membrane dendritic spine recycling endosome membrane postsynapse glutamatergic synapse ficolin 1 rich granule membraneBiologichnij proces positive regulation of Rho protein signal transduction regulation of respiratory burst non canonical Wnt signaling pathway positive regulation of protein phosphorylation positive regulation of actin filament polymerization regulation of neuron maturation negative regulation of receptor mediated endocytosis platelet activation Fc epsilon receptor signaling pathway cellular response to mechanical stimulus phagocytosis engulfment vascular endothelial growth factor receptor signaling pathway substrate adhesion dependent cell spreading proliferaciya ruffle assembly lamellipodium assembly dopaminergic neuron differentiation cell cell junction organization Fc gamma receptor signaling pathway involved in phagocytosis ruffle organization actin filament organization cell motility anatomical structure morphogenesis kistkova rezorbciya response to wounding protein localization to plasma membrane inflammatory response regulation of small GTPase mediated signal transduction positive regulation of cell substrate adhesion G protein coupled receptor signaling pathway neuron projection morphogenesis epithelial cell morphogenesis dendrite morphogenesis regulation of hydrogen peroxide metabolic process engulfment of apoptotic cell dendrite development auditory receptor cell morphogenesis hyperosmotic response cerebral cortex GABAergic interneuron development hemotaksis positive regulation of DNA replication actin filament polymerization adgeziya klitin negative regulation of interleukin 23 production homeostasis of number of cells within a tissue cell matrix adhesion localization within membrane actin cytoskeleton organization regulation of cell size anatomical structure arrangement GO 0007243 intracellular signal transduction regulation of cell migration endocitoz ephrin receptor signaling pathway T cell costimulation zsidannya krovi GO 0019049 GO 0030683 mitigation of host defenses by virus synaptic transmission GABAergic mast cell chemotaxis positive regulation of phosphatidylinositol 3 kinase activity positive regulation of substrate adhesion dependent cell spreading embryonic olfactory bulb interneuron precursor migration cytoskeleton organization cochlea morphogenesis positive regulation of neutrophil chemotaxis positive regulation of apoptotic process regulation of cell morphogenesis positive regulation of focal adhesion assembly regulation of fibroblast migration positive regulation of lamellipodium assembly cerebral cortex radially oriented cell migration cell migration semaphorin plexin signaling pathway positive regulation of stress fiber assembly axon guidance small GTPase mediated signal transduction GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity Wnt signaling pathway planar cell polarity pathway midbrain dopaminergic neuron differentiation neuron migration protein phosphorylation Rho protein signal transduction regulation of lamellipodium assembly Rac protein signal transduction cell projection assembly positive regulation of microtubule polymerization neutrophil degranulation regulation of nitric oxide biosynthetic process phosphatidylinositol phosphate biosynthetic process hepatocyte growth factor receptor signaling pathway regulation of stress fiber assembly positive regulation of protein kinase B signaling motor neuron axon guidance regulation of neutrophil migration positive regulation of insulin secretion involved in cellular response to glucose stimulusDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5879 19353Ensembl ENSG00000136238 ENSMUSG00000001847UniProt P63000 P63001RefSeq mRNK NM 198829 NM 006908 NM 018890NM 009007 NM 001347530RefSeq bilok NP 008839 NP 061485NP 001334459 NP 033033Lokus UCSC Hr 7 6 37 6 4 MbHr 5 143 49 143 51 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG AVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z nukleotidami GTF Lokalizovanij u klitinnij membrani citoplazmi membrani LiteraturaDrivas G T Shih A Coutavas E Rush M G D Eustachio P 1990 Characterization of four novel ras like genes expressed in a human teratocarcinoma cell line Mol Cell Biol 10 1793 1798 PMID 2108320 DOI 10 1128 MCB 10 4 1793 Jordan P Brazao R Boavida M G Gespach C Chastre E 1999 Cloning of a novel human Rac1b splice variant with increased expression in colorectal tumors Oncogene 18 6835 6839 PMID 10597294 DOI 10 1038 sj onc 1203233 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Ridley A J Paterson H F Johnston C L Diekmann D Hall A 1992 The small GTP binding protein rac regulates growth factor induced membrane ruffling Cell 70 401 410 PMID 1643658 DOI 10 1016 0092 8674 92 90164 8 Vincent S Settleman J 1997 The PRK2 kinase is a potential effector target of both Rho and Rac GTPases and regulates actin cytoskeletal organization Mol Cell Biol 17 2247 2256 PMID 9121475 DOI 10 1128 MCB 17 4 2247 Ren Y Li R Zheng Y Busch H 1998 Cloning and characterization of GEF H1 a microtubule associated guanine nucleotide exchange factor for Rac and Rho GTPases J Biol Chem 273 34954 34960 PMID 9857026 DOI 10 1074 jbc 273 52 34954PrimitkiZahvoryuvannya genetichno pov yazani z RAC1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9801 angl Procitovano 7 veresnya 2017 angl Arhiv originalu za 6 veresnya 2017 Procitovano 7 veresnya 2017 Div takozhHromosoma 7 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij

Дата публікації:
Топ