PRMT1 (англ. Protein arginine methyltransferase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 361 амінокислот, а молекулярна маса — 41 516.
PRMT1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | PRMT1, ANM1, HCP1, HRMT1L2, IR1B4, protein arginine methyltransferase 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 602950 MGI: 107846 HomoloGene: 21477 GeneCards: PRMT1 | ||||||||||||||||
2.1.1.321 | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 49.68 – 49.69 Mb | Хр. 7: 44.63 – 44.64 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MENFVATLAN | GMSLQPPLEE | VSCGQAESSE | KPNAEDMTSK | DYYFDSYAHF | ||||
GIHEEMLKDE | VRTLTYRNSM | FHNRHLFKDK | VVLDVGSGTG | ILCMFAAKAG | ||||
ARKVIGIECS | SISDYAVKIV | KANKLDHVVT | IIKGKVEEVE | LPVEKVDIII | ||||
SEWMGYCLFY | ESMLNTVLYA | RDKWLAPDGL | IFPDRATLYV | TAIEDRQYKD | ||||
YKIHWWENVY | GFDMSCIKDV | AIKEPLVDVV | DPKQLVTNAC | LIKEVDIYTV | ||||
KVEDLTFTSP | FCLQVKRNDY | VHALVAYFNI | EFTRCHKRTG | FSTSPESPYT | ||||
HWKQTVFYME | DYLTVKTGEE | IFGTIGMRPN | AKNNRDLDFT | IDLDFKGQLC | ||||
ELSCSTDYRM | R |
Кодований геном білок за функціями належить до трансфераз, метилтрансфераз, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з S-аденозил-L-метіоніном. Локалізований у цитоплазмі, ядрі.
Література
- Nikawa J., Nakano H., Ohi N. (1996). Structural and functional conservation of human and yeast HCP1 genes which can suppress the growth defect of the Saccharomyces cerevisiae ire15 mutant. Gene. 171: 107—111. PMID 8675017 DOI:10.1016/0378-1119(96)00073-X
- Scorilas A., Black M.H., Talieri M., Diamandis E.P. (2000). Genomic organization, physical mapping, and expression analysis of the human protein arginine methyltransferase 1 gene. Biochem. Biophys. Res. Commun. 278: 349—359. PMID 11097842 DOI:10.1006/bbrc.2000.3807
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Tang J., Kao P.N., Herschman H.R. (2000). Protein-arginine methyltransferase I, the predominant protein-arginine methyltransferase in cells, interacts with and is regulated by interleukin enhancer-binding factor 3. J. Biol. Chem. 275: 19866—19876. PMID 10749851 DOI:10.1074/jbc.M000023200
- Miyata S., Mori Y., Tohyama M. (2008). PRMT1 and Btg2 regulates neurite outgrowth of Neuro2a cells. Neurosci. Lett. 445: 162—165. PMID 18773938 DOI:10.1016/j.neulet.2008.08.065
- Pahlich S., Zakaryan R.P., Gehring H. (2008). Identification of proteins interacting with protein arginine methyltransferase 8: the Ewing sarcoma (EWS) protein binds independent of its methylation state. Proteins. 72: 1125—1137. PMID 18320585 DOI:10.1002/prot.22004
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:5187 (англ.) . Архів оригіналу за 22 березня 2016. Процитовано 12 вересня 2017. [Архівовано 2016-03-22 у Wayback Machine.]
- UniProt, Q99873 (англ.) . Архів оригіналу за 24 липня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
PRMT1 angl Protein arginine methyltransferase 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 361 aminokislot a molekulyarna masa 41 516 4 PRMT1IdentifikatoriSimvoliPRMT1 ANM1 HCP1 HRMT1L2 IR1B4 protein arginine methyltransferase 1Zovnishni ID OMIM 602950 MGI 107846 HomoloGene 21477 GeneCards PRMT1shifr KF 2 1 1 321Ontologiya genaMolekulyarna funkciya GO 0102674 GO 0102675 methyltransferase activity histone methyltransferase activity transferase activity histone methyltransferase activity H4 R3 specific methyl CpG binding mitogen activated protein kinase p38 binding GO 0001948 GO 0016582 protein binding identical protein binding enzyme binding N methyltransferase activity protein arginine omega N asymmetric methyltransferase activity RNA binding protein methyltransferase activity protein arginine N methyltransferase activity histone arginine N methyltransferase activity GO 0016275 protein arginine omega N monomethyltransferase activity S adenosyl L methionine bindingKlitinna komponenta citoplazma nukleoplazma methylosome klitinne yadro gialoplazmaBiologichnij proces positive regulation of p38MAPK cascade positive regulation of hemoglobin biosynthetic process histone H4 R3 methylation positive regulation of erythrocyte differentiation negative regulation of megakaryocyte differentiation cell surface receptor signaling pathway Metilyuvannya peptidyl arginine methylation histone methylation neuron projection development peptidyl arginine N methylation peptidyl arginine methylation to asymmetrical dimethyl arginine DNA damage response signal transduction by p53 class mediator resulting in cell cycle arrest GO 0009373 regulation of transcription DNA templated Metilyuvannya bilkiv positive regulation of cell population proliferation regulation of megakaryocyte differentiation in utero embryonic development histone arginine methylation protein homooligomerizationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3276 15469Ensembl ENSG00000126457 ENSMUSG00000109324UniProt Q99873 Q9JIF0RefSeq mRNK NM 001207042 NM 001536 NM 198318 NM 198319NM 001252476 NM 001252477 NM 019830RefSeq bilok NP 001193971 NP 001527 NP 938074NP 001239405 NP 001239406 NP 062804Lokus UCSC Hr 19 49 68 49 69 MbHr 7 44 63 44 64 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHF GIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAG ARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIII SEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKD YKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTV KVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYT HWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLC ELSCSTDYRMR A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz metiltransferaz fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z S adenozil L metioninom Lokalizovanij u citoplazmi yadri Literaturared Nikawa J Nakano H Ohi N 1996 Structural and functional conservation of human and yeast HCP1 genes which can suppress the growth defect of the Saccharomyces cerevisiae ire15 mutant Gene 171 107 111 PMID 8675017 DOI 10 1016 0378 1119 96 00073 X Scorilas A Black M H Talieri M Diamandis E P 2000 Genomic organization physical mapping and expression analysis of the human protein arginine methyltransferase 1 gene Biochem Biophys Res Commun 278 349 359 PMID 11097842 DOI 10 1006 bbrc 2000 3807 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Tang J Kao P N Herschman H R 2000 Protein arginine methyltransferase I the predominant protein arginine methyltransferase in cells interacts with and is regulated by interleukin enhancer binding factor 3 J Biol Chem 275 19866 19876 PMID 10749851 DOI 10 1074 jbc M000023200 Miyata S Mori Y Tohyama M 2008 PRMT1 and Btg2 regulates neurite outgrowth of Neuro2a cells Neurosci Lett 445 162 165 PMID 18773938 DOI 10 1016 j neulet 2008 08 065 Pahlich S Zakaryan R P Gehring H 2008 Identification of proteins interacting with protein arginine methyltransferase 8 the Ewing sarcoma EWS protein binds independent of its methylation state Proteins 72 1125 1137 PMID 18320585 DOI 10 1002 prot 22004Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 5187 angl Arhiv originalu za 22 bereznya 2016 Procitovano 12 veresnya 2017 Arhivovano 2016 03 22 u Wayback Machine UniProt Q99873 angl Arhiv originalu za 24 lipnya 2017 Procitovano 12 veresnya 2017 Div takozhred Hromosoma 19 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title PRMT1 amp oldid 44019652