PRKN (англ. Parkin RBR E3 ubiquitin protein ligase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 465 амінокислот, а молекулярна маса — 51 641.
PRKN | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | PRKN, parkin RBR E3 ubiquitin protein ligase, AR-JP, LPRS2, PDJ, PARK2, Parkin | ||||||||||||||||
Зовнішні ІД | OMIM: 602544 MGI: 1355296 HomoloGene: 3355 GeneCards: PRKN | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
рак підшлункової залози, autosomal recessive juvenile Parkinson disease 2, young-onset Parkinson disease | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 6: 161.35 – 162.73 Mb | Хр. 17: 11.06 – 12.28 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MIVFVRFNSS | HGFPVEVDSD | TSIFQLKEVV | AKRQGVPADQ | LRVIFAGKEL | ||||
RNDWTVQNCD | LDQQSIVHIV | QRPWRKGQEM | NATGGDDPRN | AAGGCEREPQ | ||||
SLTRVDLSSS | VLPGDSVGLA | VILHTDSRKD | SPPAGSPAGR | SIYNSFYVYC | ||||
KGPCQRVQPG | KLRVQCSTCR | QATLTLTQGP | SCWDDVLIPN | RMSGECQSPH | ||||
CPGTSAEFFF | KCGAHPTSDK | ETSVALHLIA | TNSRNITCIT | CTDVRSPVLV | ||||
FQCNSRHVIC | LDCFHLYCVT | RLNDRQFVHD | PQLGYSLPCV | AGCPNSLIKE | ||||
LHHFRILGEE | QYNRYQQYGA | EECVLQMGGV | LCPRPGCGAG | LLPEPDQRKV | ||||
TCEGGNGLGC | GFAFCRECKE | AYHEGECSAV | FEASGTTTQA | YRVDERAAEQ | ||||
ARWEAASKET | IKKTTKPCPR | CHVPVEKNGG | CMHMKCPQPQ | CRLEWCWNCG | ||||
CEWNRVCMGD | HWFDV |
Кодований геном білок за функціями належить до трансфераз, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, убіквітинування білків, автофагія, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі, мітохондрії, ендоплазматичному ретикулумі.
Література
- Kasap M., Akpinar G., Sazci A., Idrisoglu H.A., Vahaboglu H. (2009). Evidence for the presence of full-length PARK2 mRNA and Parkin protein in human blood. Neurosci. Lett. 460: 196—200. PMID 19501131 DOI:10.1016/j.neulet.2009.05.079
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Imai Y., Soda M., Takahashi R. (2000). Parkin suppresses unfolded protein stress-induced cell death through its E3 ubiquitin-protein ligase activity. J. Biol. Chem. 275: 35661—35664. PMID 10973942 DOI:10.1074/jbc.C000447200
- Marin I., Ferrus A. (2002). Comparative genomics of the RBR family, including the Parkinson's disease-related gene parkin and the genes of the ariadne subfamily. Mol. Biol. Evol. 19: 2039—2050. PMID 12446796 DOI:10.1093/oxfordjournals.molbev.a004029
- Huynh D.P., Scoles D.R., Nguyen D., Pulst S.M. (2003). The autosomal recessive juvenile Parkinson disease gene product, parkin, interacts with and ubiquitinates synaptotagmin XI. Hum. Mol. Genet. 12: 2587—2597. PMID 12925569 DOI:10.1093/hmg/ddg269
- Kahle P.J., Haass C. (2004). How does parkin ligate ubiquitin to Parkinson's disease?. EMBO Rep. 5: 681—685. PMID 15229644 DOI:10.1038/sj.embor.7400188
Примітки
- Захворювання, генетично пов'язані з PRKN переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:8607 (англ.) . Процитовано 6 вересня 2017.
- (англ.) . Архів оригіналу за 19 вересня 2017. Процитовано 6 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
PRKN angl Parkin RBR E3 ubiquitin protein ligase bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 465 aminokislot a molekulyarna masa 51 641 PRKNNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1IYF 2JMO 4I1F 4I1H 4BM9 5C1Z 5C23 5C9VIdentifikatoriSimvoliPRKN parkin RBR E3 ubiquitin protein ligase AR JP LPRS2 PDJ PARK2 ParkinZovnishni ID OMIM 602544 MGI 1355296 HomoloGene 3355 GeneCards PRKNPov yazani genetichni zahvoryuvannyarak pidshlunkovoyi zalozi autosomal recessive juvenile Parkinson disease 2 young onset Parkinson disease Ontologiya genaMolekulyarna funkciya phospholipase binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity SH3 domain binding histone deacetylase binding tubulin binding cullin family protein binding PDZ domain binding heat shock protein binding zv yazuvannya z ionom metalu Hsp70 protein binding kinase binding enzyme binding beta catenin binding zinc ion binding GO 0001948 GO 0016582 protein binding ubiquitin conjugating enzyme binding protein kinase binding chaperone binding GO 0000975 transcription cis regulatory region binding GO 0050372 ubiquitin protein transferase activity F box domain binding ubiquitin binding identical protein binding actin binding ubiquitin specific protease binding G protein coupled receptor binding ubiquitin protein ligase binding transferase activity GO 1904264 GO 1904822 GO 0090622 GO 0090302 ubiquitin protein ligase activity GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific GO 0032403 protein containing complex bindingKlitinna komponenta citoplazma gialoplazma mitohondriya perinuclear region of cytoplasm klitinne yadro Tilcya Levi SCF ubiquitin ligase complex aggresome endoplazmatichnij retikulum kompleks Goldzhi Parkin FBXW7 Cul1 ubiquitin ligase complex ubiquitin ligase complex LUBAC complex presynapse neuron projection mitochondrion derived vesicle nuclear speck GO 0009327 protein containing complexBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process protein K29 linked ubiquitination negative regulation of insulin secretion ERAD pathway positive regulation of mitochondrial fission positive regulation of mitophagy in response to mitochondrial depolarization GO 1903364 positive regulation of protein catabolic process synaptic transmission glutamatergic positive regulation of tumor necrosis factor mediated signaling pathway neuron cellular homeostasis regulation of protein ubiquitination cellular response to toxic substance modulation of chemical synaptic transmission regulation of synaptic vesicle transport navchennya protein monoubiquitination synaptic transmission dopaminergic positive regulation of neurotransmitter uptake regulation of glucose metabolic process protein K6 linked ubiquitination negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator negative regulation of spontaneous neurotransmitter secretion negative regulation by host of viral genome replication positive regulation of DNA binding macroautophagy negative regulation of canonical Wnt signaling pathway Unfolded Protein Response aggresome assembly proteasome mediated ubiquitin dependent protein catabolic process regulation of dopamine secretion zinc ion homeostasis free ubiquitin chain polymerization GO 0009373 regulation of transcription DNA templated locomotory behavior norepinephrine metabolic process negative regulation of endoplasmic reticulum stress induced neuron intrinsic apoptotic signaling pathway adult locomotory behavior GO 0044267 protein metabolic process negative regulation of cell death GO 0001306 response to oxidative stress protein K27 linked ubiquitination negative regulation of gene expression transcription DNA templated response to endoplasmic reticulum stress protein K11 linked ubiquitination central nervous system development negative regulation of oxidative stress induced cell death positive regulation of mitochondrial fusion protein localization to mitochondrion proteasomal protein catabolic process cellular response to manganese ion negative regulation of mitochondrial fusion protein autoubiquitination negative regulation of neuron death GO 0033128 negative regulation of protein phosphorylation negative regulation of endoplasmic reticulum stress induced intrinsic apoptotic signaling pathway negative regulation of primary amine oxidase activity perelyak mitochondrial fission regulation of mitochondrion organization regulation of canonical Wnt signaling pathway negative regulation of release of cytochrome c from mitochondria protein stabilization mitochondrion organization protein polyubiquitination GO 1901227 negative regulation of transcription by RNA polymerase II GO 1904489 regulation of reactive oxygen species metabolic process regulation of neurotransmitter secretion positive regulation of protein linear polyubiquitination protein K48 linked ubiquitination dopamine uptake involved in synaptic transmission regulation of autophagy regulation of protein targeting to mitochondrion protein destabilization negative regulation of glucokinase activity positive regulation of proteasomal protein catabolic process protein K63 linked ubiquitination cellular response to dopamine regulation of lipid transport negative regulation of actin filament bundle assembly regulation of dopamine metabolic process regulation of mitochondrial membrane potential avtofagiya negative regulation of JNK cascade dopamine metabolic process GO 1901313 positive regulation of gene expression positive regulation of I kappaB kinase NF kappaB signaling positive regulation of dendrite extension negative regulation of reactive oxygen species metabolic process GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II mitophagy Ubikvitin zalezhnij proteoliz parkin mediated stimulation of mitophagy in response to mitochondrial depolarization positive regulation of proteasomal ubiquitin dependent protein catabolic process protein deubiquitination regulation of protein stability positive regulation of protein binding mitochondrion to lysosome transport regulation of cellular response to oxidative stress negative regulation of exosomal secretion positive regulation of retrograde transport endosome to Golgi negative regulation of intralumenal vesicle formation positive regulation of protein localization to membrane autophagy of mitochondrion negative regulation of oxidative stress induced neuron intrinsic apoptotic signaling pathway positive regulation of autophagy of mitochondrion ubiquitin dependent protein catabolic process regulation of apoptotic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5071 50873Ensembl ENSG00000185345 ENSMUSG00000023826UniProt O60260 Q9WVS6RefSeq mRNK NM 004562 NM 013987 NM 013988NM 016694 NM 001317726RefSeq bilok NP 004553 NP 054642 NP 054643NP 001304655 NP 057903Lokus UCSC Hr 6 161 35 162 73 MbHr 17 11 06 12 28 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKEL RNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQ SLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYC KGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPH CPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLV FQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKE LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKV TCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQ ARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCG CEWNRVCMGDHWFDV A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi ubikvitinuvannya bilkiv avtofagiya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku Lokalizovanij u citoplazmi yadri mitohondriyi endoplazmatichnomu retikulumi LiteraturaKasap M Akpinar G Sazci A Idrisoglu H A Vahaboglu H 2009 Evidence for the presence of full length PARK2 mRNA and Parkin protein in human blood Neurosci Lett 460 196 200 PMID 19501131 DOI 10 1016 j neulet 2009 05 079 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Imai Y Soda M Takahashi R 2000 Parkin suppresses unfolded protein stress induced cell death through its E3 ubiquitin protein ligase activity J Biol Chem 275 35661 35664 PMID 10973942 DOI 10 1074 jbc C000447200 Marin I Ferrus A 2002 Comparative genomics of the RBR family including the Parkinson s disease related gene parkin and the genes of the ariadne subfamily Mol Biol Evol 19 2039 2050 PMID 12446796 DOI 10 1093 oxfordjournals molbev a004029 Huynh D P Scoles D R Nguyen D Pulst S M 2003 The autosomal recessive juvenile Parkinson disease gene product parkin interacts with and ubiquitinates synaptotagmin XI Hum Mol Genet 12 2587 2597 PMID 12925569 DOI 10 1093 hmg ddg269 Kahle P J Haass C 2004 How does parkin ligate ubiquitin to Parkinson s disease EMBO Rep 5 681 685 PMID 15229644 DOI 10 1038 sj embor 7400188PrimitkiZahvoryuvannya genetichno pov yazani z PRKN pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8607 angl Procitovano 6 veresnya 2017 angl Arhiv originalu za 19 veresnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi