POLR2G (англ. RNA polymerase II subunit G) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 172 амінокислот, а молекулярна маса — 19 294.
POLR2G | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | POLR2G, RPB19, RPB7, hRPB19, hsRPB7, polymerase (RNA) II subunit G, RNA polymerase II subunit G | ||||||||||||||||
Зовнішні ІД | OMIM: 602013 MGI: 1914960 HomoloGene: 2019 GeneCards: POLR2G | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 62.76 – 62.77 Mb | Хр. 19: 8.77 – 8.78 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MFYHISLEHE | ILLHPRYFGP | NLLNTVKQKL | FTEVEGTCTG | KYGFVIAVTT | ||||
IDNIGAGVIQ | PGRGFVLYPV | KYKAIVFRPF | KGEVVDAVVT | QVNKVGLFTE | ||||
IGPMSCFISR | HSIPSEMEFD | PNSNPPCYKT | MDEDIVIQQD | DEIRLKIVGT | ||||
RVDKNDIFAI | GSLMDDYLGL | VS |
Задіяний у такому біологічному процесі, як транскрипція. Білок має сайт для зв'язування з РНК. Локалізований у ядрі.
Література
- Khazak V., Sadhale P.P., Woychik N.A., Brent R., Golemis E.A. (1995). Human RNA polymerase II subunit hsRPB7 functions in yeast and influences stress survival and cell morphology. Mol. Biol. Cell. 6: 759—775. PMID 7579693 DOI:10.1091/mbc.6.7.759
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Kershnar E., Wu S.-Y., Chiang C.-M. (1998). Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes. J. Biol. Chem. 273: 34444—34453. PMID 9852112 DOI:10.1074/jbc.273.51.34444
- Meka H., Werner F., Cordell S.C., Onesti S., Brick P. (2005). Crystal structure and RNA binding of the Rpb4/Rpb7 subunits of human RNA polymerase II. Nucleic Acids Res. 33: 6435—6444. PMID 16282592 DOI:10.1093/nar/gki945
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 20 липня 2017. Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
POLR2G angl RNA polymerase II subunit G bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 172 aminokislot a molekulyarna masa 19 294 POLR2GNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2C35 5FLM 5IY9 5IYA 5IYC 5IYB 5IY7 5IY8 5IYD 5IY6IdentifikatoriSimvoliPOLR2G RPB19 RPB7 hRPB19 hsRPB7 polymerase RNA II subunit G RNA polymerase II subunit GZovnishni ID OMIM 602013 MGI 1914960 HomoloGene 2019 GeneCards POLR2GOntologiya genaMolekulyarna funkciya DNA directed 5 3 RNA polymerase activity single stranded DNA binding single stranded RNA binding RNA binding nucleic acid binding translation initiation factor bindingKlitinna komponenta P body nukleoplazma RNK polimeraza II klitinne yadroBiologichnij proces mRNA splicing via spliceosome positive regulation of nuclear transcribed mRNA poly A tail shortening transcription elongation from RNA polymerase II promoter 7 methylguanosine mRNA capping transcription by RNA polymerase II transcription coupled nucleotide excision repair transcription initiation from RNA polymerase II promoter positive regulation of translational initiation nuclear transcribed mRNA catabolic process exonucleolytic GO 0097285 apoptoz snRNA transcription by RNA polymerase II fibroblast growth factor receptor signaling pathway RNA metabolic process GO 1905616 regulation of gene silencing by miRNA transcription DNA templated somatic stem cell population maintenance positive regulation of viral transcriptionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5436 67710Ensembl ENSG00000168002 ENSMUSG00000071662UniProt P62487 P62488RefSeq mRNK NM 002696NM 026329RefSeq bilok NP 002687NP 080605Lokus UCSC Hr 11 62 76 62 77 MbHr 19 8 77 8 78 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTT IDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTE IGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGT RVDKNDIFAIGSLMDDYLGLVS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Zadiyanij u takomu biologichnomu procesi yak transkripciya Bilok maye sajt dlya zv yazuvannya z RNK Lokalizovanij u yadri LiteraturaKhazak V Sadhale P P Woychik N A Brent R Golemis E A 1995 Human RNA polymerase II subunit hsRPB7 functions in yeast and influences stress survival and cell morphology Mol Biol Cell 6 759 775 PMID 7579693 DOI 10 1091 mbc 6 7 759 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kershnar E Wu S Y Chiang C M 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope tagged subunits of the multiprotein complexes J Biol Chem 273 34444 34453 PMID 9852112 DOI 10 1074 jbc 273 51 34444 Meka H Werner F Cordell S C Onesti S Brick P 2005 Crystal structure and RNA binding of the Rpb4 Rpb7 subunits of human RNA polymerase II Nucleic Acids Res 33 6435 6444 PMID 16282592 DOI 10 1093 nar gki945PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 20 lipnya 2017 Procitovano 8 veresnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi