Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

PLAUR англ Plasminogen activator urokinase receptor білок який кодується однойменним геном розташованим у людей на корот

PLAUR

PLAUR

PLAUR (англ. Plasminogen activator, urokinase receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 335 амінокислот, а молекулярна маса — 36 978.

PLAUR
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PLAUR, CD87, U-PAR, UPAR, URKR, plasminogen activator, urokinase receptor
Зовнішні ІД OMIM: 173391 MGI: 97612 HomoloGene: 48120 GeneCards: PLAUR
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
5329
18793
Ensembl
ENSG00000011422
ENSMUSG00000046223
UniProt
Q03405
P35456
RefSeq (мРНК)
NM_001005376
NM_001005377
NM_001301037
NM_002659
NM_011113
RefSeq (білок)
NP_001005376
NP_001005377
NP_001287966
NP_002650
NP_035243
Локус (UCSC) Хр. 19: 43.65 – 43.67 Mb Хр. 7: 24.16 – 24.18 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTI
VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQ
GNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTH
WIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNE
GPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGT
HEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT

Кодований геном білок за функцією належить до рецепторів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних контактах, клітинних відростках. Також секретований назовні.

Література

  • Bayraktutan U., Jones P. (1993). A novel urokinase receptor on monocyte-like macrophage cell line. Biochem. Soc. Trans. 21: 395—395. PMID 8131971 DOI:10.1042/bst021395s
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Hoeyer-Hansen G., Ploug M., Behrendt N., Roenne E., Danoe K. (1997). Cell-surface acceleration of urokinase-catalyzed receptor cleavage. Eur. J. Biochem. 243: 21—26. PMID 9030717 DOI:10.1111/j.1432-1033.1997.0021a.x
  • Duke-Cohan J.S., Morimoto C., Rocker J.A., Schlossman S.F. (1995). A novel form of dipeptidylpeptidase IV found in human serum. Isolation, characterization, and comparison with T lymphocyte membrane dipeptidylpeptidase IV (CD26). J. Biol. Chem. 270: 14107—14114. PMID 7539799 DOI:10.1074/jbc.270.23.14107
  • Artym V.V., Kindzelskii A.L., Chen W.T., Petty H.R. (2002). Molecular proximity of seprase and the urokinase-type plasminogen activator receptor on malignant melanoma cell membranes: dependence on beta1 integrins and the cytoskeleton. Carcinogenesis. 23: 1593—1601. PMID 12376466 DOI:10.1093/carcin/23.10.1593
  • Casey J.R., Petranka J.G., Kottra J., Fleenor D.E., Rosse W.F. (1994). The structure of the urokinase-type plasminogen activator receptor gene. Blood. 84: 1151—1156. PMID 8049431

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:9053 (англ.) . Процитовано 12 вересня 2017.
  4. (англ.) . Архів оригіналу за 29 вересня 2017. Процитовано 12 вересня 2017.

Див. також


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

PLAUR angl Plasminogen activator urokinase receptor bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 335 aminokislot a molekulyarna masa 36 978 PLAURNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1YWH 2FD6 3BT1 3BT2 3U73 3U74 2I9B 4K24 4QTIIdentifikatoriSimvoliPLAUR CD87 U PAR UPAR URKR plasminogen activator urokinase receptorZovnishni ID OMIM 173391 MGI 97612 HomoloGene 48120 GeneCards PLAUROntologiya genaMolekulyarna funkciya protein domain specific binding GO 0001948 GO 0016582 protein binding urokinase plasminogen activator receptor activity enzyme binding signaling receptor binding signaling receptor activityKlitinna komponenta integral component of membrane cell projection endoplasmic reticulum lumen endoplasmic reticulum membrane membrana focal adhesion integral component of plasma membrane extracellular region mizhklitinni kontakti anchored component of membrane ekzosoma extrinsic component of membrane klitinna membrana specific granule membrane cell surfaceBiologichnij proces positive regulation of protein phosphorylation negative regulation of cysteine type endopeptidase activity involved in apoptotic signaling pathway fibrinoliz negative regulation of intrinsic apoptotic signaling pathway urokinase plasminogen activator signaling pathway negative regulation of apoptotic process zsidannya krovi attachment of GPI anchor to protein hemotaksis positive regulation of release of cytochrome c from mitochondria positive regulation of DNA binding positive regulation of epidermal growth factor receptor signaling pathway regulation of proteolysis GO 0072468 signalna transdukciya neutrophil degranulationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5329 18793Ensembl ENSG00000011422 ENSMUSG00000046223UniProt Q03405 P35456RefSeq mRNK NM 001005376 NM 001005377 NM 001301037 NM 002659NM 011113RefSeq bilok NP 001005376 NP 001005377 NP 001287966 NP 002650NP 035243Lokus UCSC Hr 19 43 65 43 67 MbHr 7 24 16 24 18 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTI VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQ GNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTH WIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNE GPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGT HEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do receptoriv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Lokalizovanij u klitinnij membrani membrani klitinnih kontaktah klitinnih vidrostkah Takozh sekretovanij nazovni LiteraturaBayraktutan U Jones P 1993 A novel urokinase receptor on monocyte like macrophage cell line Biochem Soc Trans 21 395 395 PMID 8131971 DOI 10 1042 bst021395s The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hoeyer Hansen G Ploug M Behrendt N Roenne E Danoe K 1997 Cell surface acceleration of urokinase catalyzed receptor cleavage Eur J Biochem 243 21 26 PMID 9030717 DOI 10 1111 j 1432 1033 1997 0021a x Duke Cohan J S Morimoto C Rocker J A Schlossman S F 1995 A novel form of dipeptidylpeptidase IV found in human serum Isolation characterization and comparison with T lymphocyte membrane dipeptidylpeptidase IV CD26 J Biol Chem 270 14107 14114 PMID 7539799 DOI 10 1074 jbc 270 23 14107 Artym V V Kindzelskii A L Chen W T Petty H R 2002 Molecular proximity of seprase and the urokinase type plasminogen activator receptor on malignant melanoma cell membranes dependence on beta1 integrins and the cytoskeleton Carcinogenesis 23 1593 1601 PMID 12376466 DOI 10 1093 carcin 23 10 1593 Casey J R Petranka J G Kottra J Fleenor D E Rosse W F 1994 The structure of the urokinase type plasminogen activator receptor gene Blood 84 1151 1156 PMID 8049431PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9053 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 29 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ