Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
PF4 (англ. Platelet factor 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. Довжина поліпептидного ланцюга білка становить 101 амінокислот, а молекулярна маса — 10 845.
| PF4 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | PF4, CXCL4, PF-4, SCYB4, platelet factor 4 | ||||||||||||||||
| Зовнішні ІД | OMIM: 173460 MGI: 1888711 HomoloGene: 87791 GeneCards: PF4 | ||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 4: 73.98 – 73.98 Mb | Хр. 5: 90.92 – 90.92 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MSSAAGFCAS | RPGLLFLGLL | LLPLVVAFAS | AEAEEDGDLQ | CLCVKTTSQV | ||||
| RPRHITSLEV | IKAGPHCPTA | QLIATLKNGR | KICLDLQAPL | YKKIIKKLLE | ||||
| S |
Кодований геном білок за функціями належить до цитокінів, фосфопротеїнів. Задіяний у такому біологічному процесі як хемотаксис. Білок має сайт для зв'язування з молекулою гепарину. Секретований назовні.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Deuel T.F., Keim P.S., Farmer M., Heinrikson R.L. (1977). Amino acid sequence of human platelet factor 4. Proc. Natl. Acad. Sci. U.S.A. 74: 2256—2258. PMID 267922 DOI:10.1073/pnas.74.6.2256
- Walz D.A., Wu V.Y., de Lamo R., Dene H., McCoy L.E. (1977). Primary structure of human platelet factor 4. Thromb. Res. 11: 893—898. PMID 601757 DOI:10.1016/0049-3848(77)90117-7
- Gupta S.K., Hassel T., Singh J.P. (1995). A potent inhibitor of endothelial cell proliferation is generated by proteolytic cleavage of the chemokine platelet factor 4. Proc. Natl. Acad. Sci. U.S.A. 92: 7799—7803. PMID 7644496 DOI:10.1073/pnas.92.17.7799
- Zhang X., Chen L., Bancroft D.P., Lai C.K., Maione T.E. (1994). Crystal structure of recombinant human platelet factor 4. Biochemistry. 33: 8361—8366. PMID 8031770 DOI:10.1021/bi00193a025
- Eisman R., Surrey S., Ramachandran B., Schwartz E., Poncz M. (1990). Structural and functional comparison of the genes for human platelet factor 4 and PF4alt. Blood. 76: 336—344. PMID 1695112
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:8861 (англ.) . Процитовано 30 серпня 2017.
{{}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url () - UniProt, P02776 (англ.) . Архів оригіналу за 14 вересня 2017. Процитовано 30 серпня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
PF4 angl Platelet factor 4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 4 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 101 aminokislot a molekulyarna masa 10 845 4 PF4Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1RHP 1DN3 1F9Q 1F9R 1F9S 1PFM 1PFN 4R9W 4R9Y 4RAUIdentifikatoriSimvoliPF4 CXCL4 PF 4 SCYB4 platelet factor 4Zovnishni ID OMIM 173460 MGI 1888711 HomoloGene 87791 GeneCards PF4Ontologiya genaMolekulyarna funkciya cytokine activity heparin binding CXCR3 chemokine receptor binding chemokine activity GO 0001948 GO 0016582 protein bindingKlitinna komponenta extracellular region platelet alpha granule lumen mizhklitinnij prostir citoplazma collagen containing extracellular matrixBiologichnij proces cytokine mediated signaling pathway chemokine mediated signaling pathway positive regulation of macrophage differentiation platelet degranulation negative regulation of megakaryocyte differentiation positive regulation of cAMP mediated signaling negative regulation of MHC class II biosynthetic process leukocyte chemotaxis hemotaksis response to lipopolysaccharide positive regulation of macrophage derived foam cell differentiation GO 1901313 positive regulation of gene expression regulation of cell population proliferation GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of tumor necrosis factor production negative regulation of angiogenesis negative regulation of extrinsic apoptotic signaling pathway in absence of ligand inflammatory response GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of cytolysis platelet activation defense response positive regulation of neutrophil chemotaxis antimicrobial humoral immune response mediated by antimicrobial peptide regulation of megakaryocyte differentiation regulation of signaling receptor activity G protein coupled receptor signaling pathway adenylate cyclase activating G protein coupled receptor signaling pathway neutrophil chemotaxis cellular response to lipopolysaccharideDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5196 56744Ensembl ENSG00000163737 ENSMUSG00000029373UniProt P02776 Q9Z126RefSeq mRNK NM 002619 NM 001363352NM 019932RefSeq bilok NP 002610 NP 001350281NP 064316Lokus UCSC Hr 4 73 98 73 98 MbHr 5 90 92 90 92 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQV RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLE S A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do citokiniv fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak hemotaksis Bilok maye sajt dlya zv yazuvannya z molekuloyu geparinu Sekretovanij nazovni Literaturared The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Deuel T F Keim P S Farmer M Heinrikson R L 1977 Amino acid sequence of human platelet factor 4 Proc Natl Acad Sci U S A 74 2256 2258 PMID 267922 DOI 10 1073 pnas 74 6 2256 Walz D A Wu V Y de Lamo R Dene H McCoy L E 1977 Primary structure of human platelet factor 4 Thromb Res 11 893 898 PMID 601757 DOI 10 1016 0049 3848 77 90117 7 Gupta S K Hassel T Singh J P 1995 A potent inhibitor of endothelial cell proliferation is generated by proteolytic cleavage of the chemokine platelet factor 4 Proc Natl Acad Sci U S A 92 7799 7803 PMID 7644496 DOI 10 1073 pnas 92 17 7799 Zhang X Chen L Bancroft D P Lai C K Maione T E 1994 Crystal structure of recombinant human platelet factor 4 Biochemistry 33 8361 8366 PMID 8031770 DOI 10 1021 bi00193a025 Eisman R Surrey S Ramachandran B Schwartz E Poncz M 1990 Structural and functional comparison of the genes for human platelet factor 4 and PF4alt Blood 76 336 344 PMID 1695112Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8861 angl Procitovano 30 serpnya 2017 a href wiki D0 A8 D0 B0 D0 B1 D0 BB D0 BE D0 BD Cite web title Shablon Cite web cite web a Obslugovuvannya CS1 Storinki z parametrom url status ale bez parametra archive url posilannya UniProt P02776 angl Arhiv originalu za 14 veresnya 2017 Procitovano 30 serpnya 2017 Div takozhred Hromosoma 4 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title PF4 amp oldid 43444595