PAX3 (англ. Paired box 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 479 амінокислот, а молекулярна маса — 52 968.
PAX3 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | PAX3, CDHS, HUP2, WS1, WS3, Pax3, paired box 3, PAX-3 | ||||||||||||||||
Зовнішні ІД | OMIM: 606597 MGI: 97487 HomoloGene: 22494 GeneCards: PAX3 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
craniofacial-deafness-hand syndrome, alveolar rhabdomyosarcoma | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 222.2 – 222.3 Mb | Хр. 1: 78.08 – 78.17 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MTTLAGAVPR | MMRPGPGQNY | PRSGFPLEVS | TPLGQGRVNQ | LGGVFINGRP | ||||
LPNHIRHKIV | EMAHHGIRPC | VISRQLRVSH | GCVSKILCRY | QETGSIRPGA | ||||
IGGSKPKQVT | TPDVEKKIEE | YKRENPGMFS | WEIRDKLLKD | AVCDRNTVPS | ||||
VSSISRILRS | KFGKGEEEEA | DLERKEAEES | EKKAKHSIDG | ILSERASAPQ | ||||
SDEGSDIDSE | PDLPLKRKQR | RSRTTFTAEQ | LEELERAFER | THYPDIYTRE | ||||
ELAQRAKLTE | ARVQVWFSNR | RARWRKQAGA | NQLMAFNHLI | PGGFPPTAMP | ||||
TLPTYQLSET | SYQPTSIPQA | VSDPSSTVHR | PQPLPPSTVH | QSTIPSNPDS | ||||
SSAYCLPSTR | HGFSSYTDSF | VPPSGPSNPM | NPTIGNGLSP | QVMGLLTNHG | ||||
GVPHQPQTDY | ALSPLTGGLE | PTTTVSASCS | QRLDHMKSLD | SLPTSQSYCP | ||||
PTYSTTGYSM | DPVTGYQYGQ | YGQSKPWTF |
Кодований геном білок за функціями належить до , фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, нейрогенез, міогенез, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Macina R.A., Barr F.G., Galili N., Riethman H.C. (1995). Genomic organization of the human PAX3 gene: DNA sequence analysis of the region disrupted in alveolar rhabdomyosarcoma. Genomics. 26: 1—8. PMID 7782066 DOI:10.1016/0888-7543(95)80076-X
- Tsukamoto K., Nakamura Y., Niikawa N. (1994). Isolation of two isoforms of the PAX3 gene transcripts and their tissue-specific alternative expression in human adult tissues. Hum. Genet. 93: 270—274. PMID 7545913 DOI:10.1007/BF00212021
- Hollenbach A.D., Sublett J.E., McPherson C.J., Grosveld G. (1999). The Pax3-FKHR oncoprotein is unresponsive to the Pax3-associated repressor hDaxx. EMBO J. 18: 3702—3711. PMID 10393185 DOI:10.1093/emboj/18.13.3702
- Morell R., Friedman T.B., Moeljopawiro S., Hartono S., Asher J.H. Jr. (1992). A frameshift mutation in the HuP2 paired domain of the probable human homolog of murine Pax-3 is responsible for Waardenburg syndrome type 1 in an Indonesian family. Hum. Mol. Genet. 1: 243—247. PMID 1303193 DOI:10.1093/hmg/1.4.243
- Wang Q., Kumar S., Slevin M., Kumar P. (2006). Functional analysis of alternative isoforms of the transcription factor PAX3 in melanocytes in vitro. Cancer Res. 66: 8574—8580. PMID 16951170 DOI:10.1158/0008-5472.CAN-06-0947
Примітки
- Захворювання, генетично пов'язані з PAX3 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:8617 (англ.) . Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 26 вересня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
PAX3 angl Paired box 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 479 aminokislot a molekulyarna masa 52 968 PAX3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3CMYIdentifikatoriSimvoliPAX3 CDHS HUP2 WS1 WS3 Pax3 paired box 3 PAX 3Zovnishni ID OMIM 606597 MGI 97487 HomoloGene 22494 GeneCards PAX3Pov yazani genetichni zahvoryuvannyacraniofacial deafness hand syndrome alveolar rhabdomyosarcoma Ontologiya genaMolekulyarna funkciya HMG box domain binding DNA binding GO 0001948 GO 0016582 protein binding sequence specific DNA binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specificKlitinna komponenta klitinne yadro nukleoplazmaBiologichnij proces animal organ morphogenesis GO 0060469 GO 0009371 positive regulation of transcription DNA templated multicellular organism development muscle organ development GO 0009373 regulation of transcription DNA templated transcription by RNA polymerase II sluh transcription DNA templated nejrobiologiya rozvitku GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II GO 0097285 apoptozDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5077 18505Ensembl ENSG00000135903 ENSMUSG00000004872UniProt P23760 P24610RefSeq mRNK NM 000438 NM 001127366 NM 013942 NM 181457 NM 181458NM 181459 NM 181460 NM 181461NM 001159520 NM 008781RefSeq bilok NP 000429 NP 001120838 NP 039230 NP 852122 NP 852123NP 852124 NP 852125 NP 852126 NP 852122 1NP 001152992 NP 032807Lokus UCSC Hr 2 222 2 222 3 MbHr 1 78 08 78 17 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRP LPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGA IGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKDAVCDRNTVPS VSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQ SDEGSDIDSEPDLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTRE ELAQRAKLTEARVQVWFSNRRARWRKQAGANQLMAFNHLIPGGFPPTAMP TLPTYQLSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDS SSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHG GVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYCP PTYSTTGYSMDPVTGYQYGQYGQSKPWTF A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi nejrogenez miogenez polimorfizm alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Macina R A Barr F G Galili N Riethman H C 1995 Genomic organization of the human PAX3 gene DNA sequence analysis of the region disrupted in alveolar rhabdomyosarcoma Genomics 26 1 8 PMID 7782066 DOI 10 1016 0888 7543 95 80076 X Tsukamoto K Nakamura Y Niikawa N 1994 Isolation of two isoforms of the PAX3 gene transcripts and their tissue specific alternative expression in human adult tissues Hum Genet 93 270 274 PMID 7545913 DOI 10 1007 BF00212021 Hollenbach A D Sublett J E McPherson C J Grosveld G 1999 The Pax3 FKHR oncoprotein is unresponsive to the Pax3 associated repressor hDaxx EMBO J 18 3702 3711 PMID 10393185 DOI 10 1093 emboj 18 13 3702 Morell R Friedman T B Moeljopawiro S Hartono S Asher J H Jr 1992 A frameshift mutation in the HuP2 paired domain of the probable human homolog of murine Pax 3 is responsible for Waardenburg syndrome type 1 in an Indonesian family Hum Mol Genet 1 243 247 PMID 1303193 DOI 10 1093 hmg 1 4 243 Wang Q Kumar S Slevin M Kumar P 2006 Functional analysis of alternative isoforms of the transcription factor PAX3 in melanocytes in vitro Cancer Res 66 8574 8580 PMID 16951170 DOI 10 1158 0008 5472 CAN 06 0947PrimitkiZahvoryuvannya genetichno pov yazani z PAX3 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8617 angl Procitovano 28 serpnya 2017 angl Arhiv originalu za 26 veresnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi