Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

PAX2 англ Paired box 2 білок який кодується однойменним геном розташованим у людей на короткому плечі 10 ї хромосоми Дов

PAX2

PAX2

PAX2 (англ. Paired box 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми. Довжина поліпептидного ланцюга білка становить 417 амінокислот, а молекулярна маса — 44 706.

PAX2
image
Ідентифікатори
Символи PAX2, PAPRS, FSGS7, paired box 2, PAX-2
Зовнішні ІД OMIM: 167409 MGI: 97486 HomoloGene: 2968 GeneCards: PAX2
Пов'язані генетичні захворювання
renal coloboma syndrome, focal segmental glomerulosclerosis 7, focal segmental glomerulosclerosis, familial idiopathic steroid-resistant nephrotic syndrome
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
5076
18504
Ensembl
ENSG00000075891
ENSMUSG00000004231
UniProt
Q02962
Q5SZP1
P32114
RefSeq (мРНК)
NM_011037
RefSeq (білок)
Локус (UCSC) Хр. 10: 100.74 – 100.83 Mb Хр. 19: 44.76 – 44.84 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVR
PCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIA
EYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIRTKVQQPFHPT
PDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEK
RKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKH
LRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGL
DEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQ
GSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSA
APRGSAPAAAAAAYDRH

Кодований геном білок за функціями належить до , фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • Stapleton P., Weith A., Urbanek P., Kozmik Z., Busslinger M. (1993). Chromosomal localization of seven PAX genes and cloning of a novel family member, PAX-9. Nat. Genet. 3: 292—298. PMID 7981748 DOI:10.1038/ng0493-292
  • Gelb A.C., Manligas G.S., Gharaybeh S., Schimmenti L.A. (2001). Identification of two novel polymorphisms (g.903C>T and g.1544C>T) in the PAX2 gene. Hum. Mutat. 17: 155—155. PMID 11180607 DOI:10.1002/1098-1004(200102)17:2<155::AID-HUMU16>3.0.CO;2-9
  • Higashide T., Wada T., Sakurai M., Yokoyama H., Sugiyama K. (2005). Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation. Am. J. Ophthalmol. 139: 203—205. PMID 15652857 DOI:10.1016/j.ajo.2004.07.021
  • Ward T.A., Nebel A., Reeve A.E., Eccles M.R. (1994). Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX-2 gene. Cell Growth Differ. 5: 1015—1021. PMID 7819127

Примітки

  1. Захворювання, генетично пов'язані з PAX2 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 18 березня 2016. Процитовано 8 вересня 2017.
  5. (англ.) . Архів оригіналу за 14 жовтня 2017. Процитовано 8 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

PAX2 angl Paired box 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 10 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 417 aminokislot a molekulyarna masa 44 706 PAX2IdentifikatoriSimvoliPAX2 PAPRS FSGS7 paired box 2 PAX 2Zovnishni ID OMIM 167409 MGI 97486 HomoloGene 2968 GeneCards PAX2Pov yazani genetichni zahvoryuvannyarenal coloboma syndrome focal segmental glomerulosclerosis 7 focal segmental glomerulosclerosis familial idiopathic steroid resistant nephrotic syndromeOntologiya genaMolekulyarna funkciya DNA binding superoxide generating NAD P H oxidase activity transcription factor binding GO 0001158 cis regulatory region sequence specific DNA binding GO 0001948 GO 0016582 protein binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activityKlitinna komponenta kompleks Goldzhi centriolar satellite centr organizaciyi mikrotrubochok protein DNA complex yaderce lizosoma klitinne yadro GO 0009327 protein containing complexBiologichnij proces cellular response to hydrogen peroxide cellular response to glucose stimulus cochlea development pronephros development cellular response to retinoic acid regulation of metanephric nephron tubule epithelial cell differentiation animal organ development ureter development diferenciaciya klitin negative regulation of cysteine type endopeptidase activity involved in apoptotic process positive regulation of branching involved in ureteric bud morphogenesis GO 0009373 regulation of transcription DNA templated positive regulation of metanephric DCT cell differentiation regulation of metanephros size aksonogeneza protein kinase B signaling negative regulation of mesenchymal cell apoptotic process involved in metanephric nephron morphogenesis negative regulation of apoptotic process involved in metanephric collecting duct development positive regulation of epithelial cell proliferation optic nerve morphogenesis pronephric field specification positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis metanephric mesenchymal cell differentiation GO 0010260 starinnya lyudini metanephric epithelium development mesenchymal to epithelial transition involved in metanephros morphogenesis negative regulation of apoptotic process glial cell differentiation transcription by RNA polymerase II retinal pigment epithelium development nephric duct formation transcription DNA templated stem cell differentiation metanephric distal convoluted tubule development reactive oxygen species metabolic process negative regulation of mesenchymal cell apoptotic process involved in metanephros development mesonephros development optic nerve structural organization GO 0060469 GO 0009371 positive regulation of transcription DNA templated cellular response to epidermal growth factor stimulus metanephric nephron tubule formation positive regulation of metanephric glomerulus development multicellular organism development branching involved in ureteric bud morphogenesis neural tube closure response to nutrient levels negative regulation of apoptotic process involved in metanephric nephron tubule development ureter maturation inner ear morphogenesis cochlea morphogenesis positive regulation of optic nerve formation positive regulation of cell population proliferation optic cup morphogenesis involved in camera type eye development urogenital system development Determinaciya negative regulation of programmed cell death vestibulocochlear nerve formation camera type eye development metanephric collecting duct development negative regulation of reactive oxygen species metabolic process mesodermal cell fate specification GO 0045996 negative regulation of transcription DNA templated metanephric mesenchyme development optic chiasma development optic nerve development GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II zir negative regulation of cytolysis brain morphogenesis mesenchymal to epithelial transitionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5076 18504Ensembl ENSG00000075891 ENSMUSG00000004231UniProt Q02962 Q5SZP1 P32114RefSeq mRNK NM 003990 NM 000278 NM 001304569 NM 003987 NM 003988NM 003989 NM 001374303NM 011037RefSeq bilok NP 000269 NP 001291498 NP 003978 NP 003979 NP 003980NP 003981 NP 001361232NP 035167 NP 001355672 NP 001355673 NP 001355674 NP 001355675NP 001355676 NP 001355677 NP 001355678 NP 001355679 NP 001355680Lokus UCSC Hr 10 100 74 100 83 MbHr 19 44 76 44 84 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIRTKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRGSAPAAAAAAYDRHA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi diferenciaciya klitin alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaStapleton P Weith A Urbanek P Kozmik Z Busslinger M 1993 Chromosomal localization of seven PAX genes and cloning of a novel family member PAX 9 Nat Genet 3 292 298 PMID 7981748 DOI 10 1038 ng0493 292 Gelb A C Manligas G S Gharaybeh S Schimmenti L A 2001 Identification of two novel polymorphisms g 903C gt T and g 1544C gt T in the PAX2 gene Hum Mutat 17 155 155 PMID 11180607 DOI 10 1002 1098 1004 200102 17 2 lt 155 AID HUMU16 gt 3 0 CO 2 9 Higashide T Wada T Sakurai M Yokoyama H Sugiyama K 2005 Macular abnormalities and optic disk anomaly associated with a new PAX2 missense mutation Am J Ophthalmol 139 203 205 PMID 15652857 DOI 10 1016 j ajo 2004 07 021 Ward T A Nebel A Reeve A E Eccles M R 1994 Alternative messenger RNA forms and open reading frames within an additional conserved region of the human PAX 2 gene Cell Growth Differ 5 1015 1021 PMID 7819127PrimitkiZahvoryuvannya genetichno pov yazani z PAX2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 18 bereznya 2016 Procitovano 8 veresnya 2017 angl Arhiv originalu za 14 zhovtnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 10Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ