Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

NR1H4 англ Nuclear receptor subfamily 1 group H member 4 білок який кодується однойменним геном розташованим у людей на

NR1H4

NR1H4

NR1H4 (англ. Nuclear receptor subfamily 1 group H member 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 486 амінокислот, а молекулярна маса — 55 914.

NR1H4
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR1H4, BAR, FXR, HRR-1, HRR1, RIP14, nuclear receptor subfamily 1 group H member 4, PFIC5
Зовнішні ІД OMIM: 603826 MGI: 1352464 HomoloGene: 3760 GeneCards: NR1H4
Реагує на сполуку
chenodiol, fexaramine, obeticholic acid, (E)-guggulsterone
nidufexor
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
9971
20186
Ensembl
ENSG00000012504
ENSMUSG00000047638
UniProt
Q96RI1
Q60641
RefSeq (мРНК)
NM_001163504
NM_001163700
NM_009108
NM_001385711
RefSeq (білок)
NP_001156976
NP_001157172
NP_033134
NP_001372640
Локус (UCSC) Хр. 12: 100.47 – 100.56 Mb Хр. 10: 89.29 – 89.37 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQN
LEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRR
MPAETLYQGETEVAEMPVTKKPRMGASAGRIKGDELCVVCGDRASGYHYN
ALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCKEM
GMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTT
KSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLI
LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIF
NKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLT
AIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGR
LTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

Кодований геном білок за функціями належить до репресорів, рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, транскрипція, регуляція транскрипції, запальна відповідь, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Kanaya E., Shiraki T., Jingami H. (2004). The nuclear bile acid receptor FXR is activated by PGC-1alpha in a ligand-dependent manner. Biochem. J. 382: 913—921. PMID 15202934 DOI:10.1042/BJ20040432
  • Neimark E., Chen F., Li X., Shneider B.L. (2004). Bile acid-induced negative feedback regulation of the human ileal bile acid transporter. Hepatology. 40: 149—156. PMID 15239098 DOI:10.1002/hep.20295
  • Pineda Torra I., Freedman L.P., Garabedian M.J. (2004). Identification of DRIP205 as a coactivator for the Farnesoid X receptor. J. Biol. Chem. 279: 36184—36191. PMID 15187081 DOI:10.1074/jbc.M405126200
  • Hirokane H., Nakahara M., Tachibana S., Shimizu M., Sato R. (2004). Bile acid reduces the secretion of very low density lipoprotein by repressing microsomal triglyceride transfer protein gene expression mediated by hepatocyte nuclear factor-4. J. Biol. Chem. 279: 45685—45692. PMID 15337761 DOI:10.1074/jbc.M404255200
  • Ananthanarayanan M., Li S., Balasubramaniyan N., Suchy F.J., Walsh M.J. (2004). Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1. J. Biol. Chem. 279: 54348—54357. PMID 15471871 DOI:10.1074/jbc.M410021200

Примітки

  1. Сполуки, які фізично взаємодіють з Nuclear receptor subfamily 1 group H member 4 переглянути/редагувати посилання на ВікіДаних.
  2. Сполуки, які фізично взаємодіють з Farnesoid X nuclear receptor переглянути/редагувати посилання на ВікіДаних.
  3. Human PubMed Reference:.
  4. Mouse PubMed Reference:.
  5. HUGO Gene Nomenclature Commitee, HGNC:7967 (англ.) . Процитовано 11 вересня 2017.
  6. (англ.) . Архів оригіналу за 5 вересня 2017. Процитовано 11 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

NR1H4 angl Nuclear receptor subfamily 1 group H member 4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 486 aminokislot a molekulyarna masa 55 914 NR1H4Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1OSH 3BEJ 3DCT 3DCU 3FLI 3FXV 3GD2 3HC5 3HC6 3L1B 3OKH 3OKI 3OLF 3OMK 3OMM 3OOF 3OOK 3RUT 3RUU 3RVF 3P88 3P89 4OIV 4WVD 4QE6 4QE8IdentifikatoriSimvoliNR1H4 BAR FXR HRR 1 HRR1 RIP14 nuclear receptor subfamily 1 group H member 4 PFIC5Zovnishni ID OMIM 603826 MGI 1352464 HomoloGene 3760 GeneCards NR1H4Reaguye na spolukuchenodiol fexaramine obeticholic acid E guggulsterone nidufexor Ontologiya genaMolekulyarna funkciya GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding sequence specific DNA binding DNA binding GO 0001106 transcription corepressor activity GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001105 transcription coactivator activity zinc ion binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific zv yazuvannya z ionom metalu retinoid X receptor binding steroid hormone receptor activity bile acid binding GO 0001948 GO 0016582 protein binding nuclear receptor binding transcription factor activity RNA polymerase II distal enhancer sequence specific binding chenodeoxycholic acid binding GO 0000975 transcription cis regulatory region binding RNA polymerase II transcription regulatory region sequence specific DNA binding GO 0038050 GO 0004886 GO 0038051 nuclear receptor activity bile acid receptor activity GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific transcription factor binding nuclear receptor coactivator activity signaling receptor activityKlitinna komponenta nukleoplazma klitinne yadro RNA polymerase II transcription regulator complexBiologichnij proces Signalnij shlyah Notch cellular triglyceride homeostasis cellular response to organonitrogen compound regulation of insulin secretion involved in cellular response to glucose stimulus positive regulation of ammonia assimilation cycle toll like receptor 4 signaling pathway proces imunnoyi sistemi histone H3 R17 methylation GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II positive regulation of glutamate metabolic process intracellular bile acid receptor signaling pathway negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II transcription DNA templated regulation of low density lipoprotein particle clearance regulation of bile acid biosynthetic process regulation of cholesterol metabolic process regulation of urea metabolic process intracellular receptor signaling pathway negative regulation of bile acid biosynthetic process cellular response to fatty acid bile acid and bile salt transport nitrogen catabolite activation of transcription from RNA polymerase II promoter transcription initiation from RNA polymerase II promoter inflammatory response vrodzhenij imunitet GO 0072468 signalna transdukciya steroid hormone mediated signaling pathway fatty acid homeostasis GO 1903106 positive regulation of insulin receptor signaling pathway cellular response to lipopolysaccharide negative regulation of interleukin 2 production positive regulation of insulin secretion involved in cellular response to glucose stimulus negative regulation of inflammatory response glucose homeostasis negative regulation of NF kappaB transcription factor activity positive regulation of adipose tissue development cell cell junction assembly toll like receptor 9 signaling pathway negative regulation of monocyte chemotactic protein 1 production bile acid metabolic process negative regulation of I kappaB kinase NF kappaB signaling negative regulation of tumor necrosis factor mediated signaling pathway defense response to bacterium negative regulation of interleukin 1 production negative regulation of tumor necrosis factor production negative regulation of interleukin 6 production triglyceride homeostasis negative regulation of interferon gamma production GO 0009373 regulation of transcription DNA templated bile acid signaling pathway GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of phosphatidic acid biosynthetic process cholesterol homeostasis lipid metabolism multicellular organism development diferenciaciya klitin lipid homeostasis cellular glucose homeostasisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez9971 20186Ensembl ENSG00000012504 ENSMUSG00000047638UniProt Q96RI1 Q60641RefSeq mRNK NM 001206977 NM 001206978 NM 001206979 NM 001206992 NM 001206993NM 005123NM 001163504 NM 001163700 NM 009108 NM 001385711RefSeq bilok NP 001193906 NP 001193907 NP 001193908 NP 001193921 NP 001193922NP 005114 NP 001193906 1 NP 001193908 1NP 001156976 NP 001157172 NP 033134 NP 001372640Lokus UCSC Hr 12 100 47 100 56 MbHr 10 89 29 89 37 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQN LEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRR MPAETLYQGETEVAEMPVTKKPRMGASAGRIKGDELCVVCGDRASGYHYN ALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCKEM GMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTT KSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLI LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIF NKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLT AIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGR LTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv receptoriv aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak imunitet vrodzhenij imunitet transkripciya regulyaciya transkripciyi zapalna vidpovid acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK Lokalizovanij u yadri LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kanaya E Shiraki T Jingami H 2004 The nuclear bile acid receptor FXR is activated by PGC 1alpha in a ligand dependent manner Biochem J 382 913 921 PMID 15202934 DOI 10 1042 BJ20040432 Neimark E Chen F Li X Shneider B L 2004 Bile acid induced negative feedback regulation of the human ileal bile acid transporter Hepatology 40 149 156 PMID 15239098 DOI 10 1002 hep 20295 Pineda Torra I Freedman L P Garabedian M J 2004 Identification of DRIP205 as a coactivator for the Farnesoid X receptor J Biol Chem 279 36184 36191 PMID 15187081 DOI 10 1074 jbc M405126200 Hirokane H Nakahara M Tachibana S Shimizu M Sato R 2004 Bile acid reduces the secretion of very low density lipoprotein by repressing microsomal triglyceride transfer protein gene expression mediated by hepatocyte nuclear factor 4 J Biol Chem 279 45685 45692 PMID 15337761 DOI 10 1074 jbc M404255200 Ananthanarayanan M Li S Balasubramaniyan N Suchy F J Walsh M J 2004 Ligand dependent activation of the farnesoid X receptor directs arginine methylation of histone H3 by CARM1 J Biol Chem 279 54348 54357 PMID 15471871 DOI 10 1074 jbc M410021200PrimitkiSpoluki yaki fizichno vzayemodiyut z Nuclear receptor subfamily 1 group H member 4 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Farnesoid X nuclear receptor pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7967 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 5 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 12 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ