NCK1 (англ. NCK adaptor protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 377 амінокислот, а молекулярна маса — 42 864.
NCK1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | NCK1, NCK, NCKalpha, nck-1, NCK adaptor protein 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 600508 MGI: 109601 HomoloGene: 38148 GeneCards: NCK1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 3: 136.86 – 136.95 Mb | Хр. 9: 100.37 – 100.43 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAEEVVVVAK | FDYVAQQEQE | LDIKKNERLW | LLDDSKSWWR | VRNSMNKTGF | ||||
VPSNYVERKN | SARKASIVKN | LKDTLGIGKV | KRKPSVPDSA | SPADDSFVDP | ||||
GERLYDLNMP | AYVKFNYMAE | REDELSLIKG | TKVIVMEKCS | DGWWRGSYNG | ||||
QVGWFPSNYV | TEEGDSPLGD | HVGSLSEKLA | AVVNNLNTGQ | VLHVVQALYP | ||||
FSSSNDEELN | FEKGDVMDVI | EKPENDPEWW | KCRKINGMVG | LVPKNYVTVM | ||||
QNNPLTSGLE | PSPPQCDYIR | PSLTGKFAGN | PWYYGKVTRH | QAEMALNERG | ||||
HEGDFLIRDS | ESSPNDFSVS | LKAQGKNKHF | KVQLKETVYC | IGQRKFSTME | ||||
ELVEHYKKAP | IFTSEQGEKL | YLVKHLS |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як регуляція трансляції, поліморфізм, ацетиляція, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі, ендоплазматичному ретикулумі.
Література
- Lehmann J.M., Riethmueller G., Johnson J.P. (1990). Nck, a melanoma cDNA encoding a cytoplasmic protein consisting of the src homology units SH2 and SH3. Nucleic Acids Res. 18: 1048—1048. PMID 2107526 DOI:10.1093/nar/18.4.1048
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Park D., Rhee S.G. (1992). Phosphorylation of Nck in response to a variety of receptors, phorbol myristate acetate, and cyclic AMP. Mol. Cell. Biol. 12: 5816—5823. PMID 1333046 DOI:10.1128/MCB.12.12.5816
- Meisenhelder J., Hunter T. (1992). The SH2/SH3 domain-containing protein Nck is recognized by certain anti-phospholipase C-gamma 1 monoclonal antibodies, and its phosphorylation on tyrosine is stimulated by platelet-derived growth factor and epidermal growth factor treatment. Mol. Cell. Biol. 12: 5843—5856. PMID 1448108 DOI:10.1128/MCB.12.12.5843
- Matuoka K., Miki H., Takahashi K., Takenawa T. (1997). A novel ligand for an SH3 domain of the adaptor protein Nck bears an SH2 domain and nuclear signaling motifs. Biochem. Biophys. Res. Commun. 239: 488—492. PMID 9344857 DOI:10.1006/bbrc.1997.7492
- Fu C., Turck C.W., Kurosaki T., Chan A.C. (1998). BLNK: a central linker protein in B cell activation. Immunity. 9: 93—103. PMID 9697839 DOI:10.1016/S1074-7613(00)80591-9
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 28 березня 2016. Процитовано 30 серпня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 30 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
NCK1 angl NCK adaptor protein 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 377 aminokislot a molekulyarna masa 42 864 NCK1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2CI8 2CI9 2JS0 2JS2 2JW4IdentifikatoriSimvoliNCK1 NCK NCKalpha nck 1 NCK adaptor protein 1Zovnishni ID OMIM 600508 MGI 109601 HomoloGene 38148 GeneCards NCK1Ontologiya genaMolekulyarna funkciya protein macromolecule adaptor activity protein domain specific binding receptor tyrosine kinase binding protein kinase inhibitor activity GO 0001948 GO 0016582 protein binding cytoskeletal anchor activity signaling receptor complex adaptor activity signaling receptor binding eukaryotic initiation factor eIF2 binding ephrin receptor binding cadherin binding GO 0032947 molecular adaptor activityKlitinna komponenta gialoplazma ribosoma cell cell junction vesicle membrane protein phosphatase type 1 complex endoplazmatichnij retikulum klitinne yadro citoplazma klitinna membranaBiologichnij proces positive regulation of endoplasmic reticulum stress induced intrinsic apoptotic signaling pathway Fc gamma receptor signaling pathway involved in phagocytosis actin filament organization positive regulation of translation in response to endoplasmic reticulum stress substrate dependent cell migration cell extension signal complex assembly negative regulation of cell death positive regulation of cap independent translational initiation positive regulation of cap dependent translational initiation peptidyl serine dephosphorylation vascular endothelial growth factor receptor signaling pathway response to other organism positive regulation of T cell proliferation negative regulation of peptidyl serine phosphorylation negative regulation of endoplasmic reticulum stress induced eIF2 alpha phosphorylation T cell receptor signaling pathway negative regulation of PERK mediated unfolded protein response cell migration negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress regulation of translation T cell activation lamellipodium assembly GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of protein kinase activity positive regulation of actin filament polymerization regulation of cell migration ephrin receptor signaling pathway positive regulation of neuron projection development GO 1903105 negative regulation of insulin receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4690 17973Ensembl ENSG00000158092 ENSMUSG00000032475UniProt P16333 Q99M51RefSeq mRNK NM 006153 NM 001190796 NM 001291999NM 010878 NM 001324530RefSeq bilok NP 001177725 NP 001278928 NP 006144NP 001311459 NP 035008Lokus UCSC Hr 3 136 86 136 95 MbHr 9 100 37 100 43 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGF VPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDP GERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNG QVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYP FSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVM QNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTME ELVEHYKKAPIFTSEQGEKLYLVKHLS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak regulyaciya translyaciyi polimorfizm acetilyaciya alternativnij splajsing Lokalizovanij u citoplazmi yadri endoplazmatichnomu retikulumi LiteraturaLehmann J M Riethmueller G Johnson J P 1990 Nck a melanoma cDNA encoding a cytoplasmic protein consisting of the src homology units SH2 and SH3 Nucleic Acids Res 18 1048 1048 PMID 2107526 DOI 10 1093 nar 18 4 1048 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Park D Rhee S G 1992 Phosphorylation of Nck in response to a variety of receptors phorbol myristate acetate and cyclic AMP Mol Cell Biol 12 5816 5823 PMID 1333046 DOI 10 1128 MCB 12 12 5816 Meisenhelder J Hunter T 1992 The SH2 SH3 domain containing protein Nck is recognized by certain anti phospholipase C gamma 1 monoclonal antibodies and its phosphorylation on tyrosine is stimulated by platelet derived growth factor and epidermal growth factor treatment Mol Cell Biol 12 5843 5856 PMID 1448108 DOI 10 1128 MCB 12 12 5843 Matuoka K Miki H Takahashi K Takenawa T 1997 A novel ligand for an SH3 domain of the adaptor protein Nck bears an SH2 domain and nuclear signaling motifs Biochem Biophys Res Commun 239 488 492 PMID 9344857 DOI 10 1006 bbrc 1997 7492 Fu C Turck C W Kurosaki T Chan A C 1998 BLNK a central linker protein in B cell activation Immunity 9 93 103 PMID 9697839 DOI 10 1016 S1074 7613 00 80591 9PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 28 bereznya 2016 Procitovano 30 serpnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 3 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij