MYC (англ. MYC proto-oncogene, bHLH transcription factor) – сім'я регуляторних генів та прото-онкогенів, які кодують однойменні фактори транскрипції. Сімейство Myc складається з трьох споріднених генів людини: c-myc, l-myc і n-myc. c-myc був першим геном, виявленим у цій родині, завдяки гомології з вірусним геном v-myc. При раку c-myc часто виражається конститутивно. Розташований у людей на короткому плечі 8-ї хромосоми. Довжина поліпептидного ланцюга білка становить 439 амінокислот, а молекулярна маса — 48 804.
MYC | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | MYC, MRTL, MYCC, bHLHe39, c-Myc, v-myc avian myelocytomatosis viral oncogene homolog, MYC proto-oncogene, bHLH transcription factor, Genes, myc, c-myc | ||||||||||||||||
Зовнішні ІД | OMIM: 190080 MGI: 97250 HomoloGene: 31092 GeneCards: MYC | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 8: 127.74 – 127.74 Mb | Хр. 15: 61.86 – 61.86 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MPLNVSFTNR | NYDLDYDSVQ | PYFYCDEEEN | FYQQQQQSEL | QPPAPSEDIW | ||||
KKFELLPTPP | LSPSRRSGLC | SPSYVAVTPF | SLRGDNDGGG | GSFSTADQLE | ||||
MVTELLGGDM | VNQSFICDPD | DETFIKNIII | QDCMWSGFSA | AAKLVSEKLA | ||||
SYQAARKDSG | SPNPARGHSV | CSTSSLYLQD | LSAAASECID | PSVVFPYPLN | ||||
DSSSPKSCAS | QDSSAFSPSS | DSLLSSTESS | PQGSPEPLVL | HEETPPTTSS | ||||
DSEEEQEDEE | EIDVVSVEKR | QAPGKRSESG | SPSAGGHSKP | PHSPLVLKRC | ||||
HVSTHQHNYA | APPSTRKDYP | AAKRVKLDSV | RVLRQISNNR | KCTSPRSSDT | ||||
EENVKRRTHN | VLERQRRNEL | KRSFFALRDQ | IPELENNEKA | PKVVILKKAT | ||||
AYILSVQAEE | QKLISEEDLL | RKRREQLKHK | LEQLRNSCA |
Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.
Література
- Colby W.W., Chen E.Y., Smith D.H., Levinson A.D. (1983). Identification and nucleotide sequence of a human locus homologous to the v-myc oncogene of avian myelocytomatosis virus MC29. Nature. 301: 722—725. PMID 6298632 DOI:10.1038/301722a0
- Rabbitts T.H., Hamlyn P.H., Baer R. (1983). Altered nucleotide sequences of a translocated c-myc gene in Burkitt lymphoma. Nature. 306: 760—765. PMID 6419122 DOI:10.1038/306760a0
- Watson D.K., Psallidopoulos M.C., Samuel K.P., Dalla-Favera R., Papas T.S. (1983). Nucleotide sequence analysis of human c-myc locus, chicken homologue, and myelocytomatosis virus MC29 transforming gene reveals a highly conserved gene product. Proc. Natl. Acad. Sci. U.S.A. 80: 3642—3645. PMID 6304729 DOI:10.1073/pnas.80.12.3642
- Rabbitts T.H., Forster A., Hamlyn P., Baer R. (1984). Effect of somatic mutation within translocated c-myc genes in Burkitt's lymphoma. Nature. 309: 592—597. PMID 6547209 DOI:10.1038/309592a0
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Bentley D.L., Groudine M. (1986). Novel promoter upstream of the human c-myc gene and regulation of c-myc expression in B-cell lymphomas. Mol. Cell. Biol. 6: 3481—3489. PMID 3540591 DOI:10.1128/MCB.6.10.3481
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 31 травня 2017. Процитовано 7 вересня 2017.
- (англ.) . Архів оригіналу за 5 вересня 2017. Процитовано 7 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
MYC angl MYC proto oncogene bHLH transcription factor sim ya regulyatornih geniv ta proto onkogeniv yaki koduyut odnojmenni faktori transkripciyi Simejstvo Myc skladayetsya z troh sporidnenih geniv lyudini c myc l myc i n myc c myc buv pershim genom viyavlenim u cij rodini zavdyaki gomologiyi z virusnim genom v myc Pri raku c myc chasto virazhayetsya konstitutivno Roztashovanij u lyudej na korotkomu plechi 8 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 439 aminokislot a molekulyarna masa 48 804 MYCNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1A93 1EE4 1MV0 1NKP 2A93 2OR9 4Y7RIdentifikatoriSimvoliMYC MRTL MYCC bHLHe39 c Myc v myc avian myelocytomatosis viral oncogene homolog MYC proto oncogene bHLH transcription factor Genes myc c mycZovnishni ID OMIM 190080 MGI 97250 HomoloGene 31092 GeneCards MYCOntologiya genaMolekulyarna funkciya DNA binding protein dimerization activity GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific transcription factor binding GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding E box binding GO 0001948 GO 0016582 protein binding GO 0032403 protein containing complex binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specificKlitinna komponenta nukleoplazma yaderce klitinne yadro GO 0009327 protein containing complexBiologichnij proces Signalnij shlyah Notch remodelyuvannya hromatinu negative regulation of monocyte differentiation positive regulation of metanephric cap mesenchymal cell proliferation GO 0009373 regulation of transcription DNA templated regulation of telomere maintenance positive regulation of epithelial cell proliferation positive regulation of fibroblast proliferation cellular response to UV oxygen transport negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II GO 0051312 GO 0007083 chromosome organization MAPK cascade cellular response to DNA damage stimulus positive regulation of cysteine type endopeptidase activity involved in apoptotic process branching involved in ureteric bud morphogenesis negative regulation of cell division fibroblast apoptotic process positive regulation of mesenchymal cell proliferation positive regulation of response to DNA damage stimulus positive regulation of cell population proliferation positive regulation of DNA biosynthetic process regulyaciya ekspresiyi geniv canonical Wnt signaling pathway negative regulation of stress activated MAPK cascade energy reserve metabolic process response to growth factor response to gamma radiation negative regulation of fibroblast proliferation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II cellular iron ion homeostasis beta catenin TCF complex assembly transcription DNA templated transcription by RNA polymerase II GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II protein deubiquitination GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of telomerase activity GO 1901313 positive regulation of gene expression protein DNA complex disassembly ERK1 and ERK2 cascade cellular response to hypoxia G1 S transition of mitotic cell cycle cytokine mediated signaling pathway positive regulation of DNA methylationDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez4609 17869Ensembl ENSG00000136997 ENSMUSG00000022346UniProt P01106 P01108RefSeq mRNK NM 002467 NM 001354870NM 001177352 NM 001177353 NM 001177354 NM 010849RefSeq bilok NP 002458 NP 001341799NP 001170823 NP 001170824 NP 001170825 NP 034979Lokus UCSC Hr 8 127 74 127 74 MbHr 15 61 86 61 86 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIW KKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLE MVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLA SYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLN DSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSS DSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDT EENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKAT AYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaColby W W Chen E Y Smith D H Levinson A D 1983 Identification and nucleotide sequence of a human locus homologous to the v myc oncogene of avian myelocytomatosis virus MC29 Nature 301 722 725 PMID 6298632 DOI 10 1038 301722a0 Rabbitts T H Hamlyn P H Baer R 1983 Altered nucleotide sequences of a translocated c myc gene in Burkitt lymphoma Nature 306 760 765 PMID 6419122 DOI 10 1038 306760a0 Watson D K Psallidopoulos M C Samuel K P Dalla Favera R Papas T S 1983 Nucleotide sequence analysis of human c myc locus chicken homologue and myelocytomatosis virus MC29 transforming gene reveals a highly conserved gene product Proc Natl Acad Sci U S A 80 3642 3645 PMID 6304729 DOI 10 1073 pnas 80 12 3642 Rabbitts T H Forster A Hamlyn P Baer R 1984 Effect of somatic mutation within translocated c myc genes in Burkitt s lymphoma Nature 309 592 597 PMID 6547209 DOI 10 1038 309592a0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bentley D L Groudine M 1986 Novel promoter upstream of the human c myc gene and regulation of c myc expression in B cell lymphomas Mol Cell Biol 6 3481 3489 PMID 3540591 DOI 10 1128 MCB 6 10 3481PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 31 travnya 2017 Procitovano 7 veresnya 2017 angl Arhiv originalu za 5 veresnya 2017 Procitovano 7 veresnya 2017 Div takozhHromosoma 8 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi