Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
MIA (англ. Melanoma inhibitory activity) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 131 амінокислот, а молекулярна маса — 14 509.
| MIA | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | MIA, CD-RAP, Melanoma inhibitory activity, MIA SH3 domain containing | ||||||||||||||||
| Зовнішні ІД | OMIM: 601340 MGI: 109615 HomoloGene: 4763 GeneCards: MIA | ||||||||||||||||
| |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | н/д | Хр. 7: 26.88 – 26.88 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MARSLVCLGV | IILLSAFSGP | GVRGGPMPKL | ADRKLCADQE | CSHPISMAVA | ||||
| LQDYMAPDCR | FLTIHRGQVV | YVFSKLKGRG | RLFWGGSVQG | DYYGDLAARL | ||||
| GYFPSSIVRE | DQTLKPGKVD | VKTDKWDFYC | Q |
Кодований геном білок за функцією належить до факторів росту. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Секретований назовні.
Література
- Bosserhoff A.-K., Hein R., Bogdahn U., Buettner R. (1996). Structure and promoter analysis of the gene encoding the human melanoma-inhibiting protein MIA. J. Biol. Chem. 271: 490—495. PMID 8550608 DOI:10.1074/jbc.271.1.490
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504
- Voss M., Lettau M., Janssen O. (2009). Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening. BMC Immunol. 10: 53—53. PMID 19807924 DOI:10.1186/1471-2172-10-53
- Rahimi N., Rezazadeh K., Mahoney J.E., Hartsough E., Meyer R.D. (2012). Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis. Mol. Biol. Cell. 23: 1646—1656. PMID 22419821 DOI:10.1091/mbc.E11-11-0934
- Lougheed J.C., Holton J.M., Alber T., Bazan J.F., Handel T.M. (2001). Structure of melanoma inhibitory activity protein, a member of a recently identified family of secreted proteins. Proc. Natl. Acad. Sci. U.S.A. 98: 5515—5520. PMID 11331761 DOI:10.1073/pnas.091601698
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:7076 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 3 березня 2018. Процитовано 12 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
MIA angl Melanoma inhibitory activity bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 131 aminokislot a molekulyarna masa 14 509 MIANayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1HJD 1I1J 1K0XIdentifikatoriSimvoliMIA CD RAP Melanoma inhibitory activity MIA SH3 domain containingZovnishni ID OMIM 601340 MGI 109615 HomoloGene 4763 GeneCards MIAOntologiya genaMolekulyarna funkciya growth factor activityKlitinna komponenta extracellular region mizhklitinnij prostirBiologichnij proces proliferaciya regulation of signaling receptor activity GO 0072468 signalna transdukciyaDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez8190 12587Ensembl n d ENSMUSG00000089661UniProt Q16674 Q61865RefSeq mRNK NM 006533 NM 001202553NM 019394RefSeq bilok NP 001189482 NP 006524NP 062267Lokus UCSC n dHr 7 26 88 26 88 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do faktoriv rostu Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Sekretovanij nazovni LiteraturaBosserhoff A K Hein R Bogdahn U Buettner R 1996 Structure and promoter analysis of the gene encoding the human melanoma inhibiting protein MIA J Biol Chem 271 490 495 PMID 8550608 DOI 10 1074 jbc 271 1 490 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504 Voss M Lettau M Janssen O 2009 Identification of SH3 domain interaction partners of human FasL CD178 by phage display screening BMC Immunol 10 53 53 PMID 19807924 DOI 10 1186 1471 2172 10 53 Rahimi N Rezazadeh K Mahoney J E Hartsough E Meyer R D 2012 Identification of IGPR 1 as a novel adhesion molecule involved in angiogenesis Mol Biol Cell 23 1646 1656 PMID 22419821 DOI 10 1091 mbc E11 11 0934 Lougheed J C Holton J M Alber T Bazan J F Handel T M 2001 Structure of melanoma inhibitory activity protein a member of a recently identified family of secreted proteins Proc Natl Acad Sci U S A 98 5515 5520 PMID 11331761 DOI 10 1073 pnas 091601698PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7076 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 3 bereznya 2018 Procitovano 12 veresnya 2017 Div takozhHromosoma 19Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi