MC2R (англ. Melanocortin 2 receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми. Довжина поліпептидного ланцюга білка становить 297 амінокислот, а молекулярна маса — 33 927.
MC2R | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | MC2R, ACTHR, melanocortin 2 receptor | ||||||||||||||||
Зовнішні ІД | OMIM: 607397 MGI: 96928 HomoloGene: 444 GeneCards: MC2R | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
адренокортикотропний гормон | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 18: 13.88 – 13.92 Mb | Хр. 18: 68.54 – 68.56 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MKHIINSYEN | INNTARNNSD | CPRVVLPEEI | FFTISIVGVL | ENLIVLLAVF | ||||
KNKNLQAPMY | FFICSLAISD | MLGSLYKILE | NILIILRNMG | YLKPRGSFET | ||||
TADDIIDSLF | VLSLLGSIFS | LSVIAADRYI | TIFHALRYHS | IVTMRRTVVV | ||||
LTVIWTFCTG | TGITMVIFSH | HVPTVITFTS | LFPLMLVFIL | CLYVHMFLLA | ||||
RSHTRKISTL | PRANMKGAIT | LTILLGVFIF | CWAPFVLHVL | LMTFCPSNPY | ||||
CACYMSLFQV | NGMLIMCNAV | IDPFIYAFRS | PELRDAFKKM | IFCSRYW |
Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, . Локалізований у клітинній мембрані, мембрані.
Література
- Mountjoy K.G., Robbins L.S., Mortrud M., Cone R.D. (1992). The cloning of a family of genes that encode the melanocortin receptors. Science. 257: 1248—1251. PMID 1325670 DOI:10.1126/science.1325670
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Sebag J.A., Hinkle P.M. (2010). Regulation of G protein-coupled receptor signaling: specific dominant-negative effects of melanocortin 2 receptor accessory protein 2. Sci. Signal. 3: RA28—RA28. PMID 20371771 DOI:10.1126/scisignal.2000593
- Clark A.J.L., McLoughlin L., Grossman A. (1993). Familial glucocorticoid deficiency associated with point mutation in the adrenocorticotropin receptor. Lancet. 341: 461—462. PMID 8094489 DOI:10.1016/0140-6736(93)90208-X
- Tsigos C., Arai K., Hung W., Chrousos G.P. (1993). Hereditary isolated glucocorticoid deficiency is associated with abnormalities of the adrenocorticotropin receptor gene. J. Clin. Invest. 92: 2458—2461. PMID 8227361 DOI:10.1172/JCI116853
- Fluck C.E., Martens J.W.M., Conte F.A., Miller W.L. (2002). Clinical, genetic, and functional characterization of adrenocorticotropin receptor mutations using a novel receptor assay. J. Clin. Endocrinol. Metab. 87: 4318—4323. PMID 12213892 DOI:10.1210/jc.2002-020501
Примітки
- Сполуки, які фізично взаємодіють з MC2R переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:6930 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 25 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
MC2R angl Melanocortin 2 receptor bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 18 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 297 aminokislot a molekulyarna masa 33 927 MC2RIdentifikatoriSimvoliMC2R ACTHR melanocortin 2 receptorZovnishni ID OMIM 607397 MGI 96928 HomoloGene 444 GeneCards MC2RReaguye na spolukuadrenokortikotropnij gormon Ontologiya genaMolekulyarna funkciya melanocortin receptor activity GO 0001948 GO 0016582 protein binding G protein coupled receptor activity corticotropin receptor activity signal transducer activityKlitinna komponenta citoplazma integral component of membrane klitinna membrana integral component of plasma membrane membranaBiologichnij proces G protein coupled receptor signaling pathway G protein coupled receptor signaling pathway coupled to cyclic nucleotide second messenger GO 0072468 signalna transdukciya placenta development neuropeptide signaling pathway adenylate cyclase activating G protein coupled receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4158 17200Ensembl ENSG00000185231 ENSMUSG00000045569UniProt Q01718 Q64326RefSeq mRNK NM 001291911 NM 000529NM 001271716 NM 001271717 NM 008560 NM 001301372RefSeq bilok NP 000520 NP 001278840NP 001258645 NP 001258646 NP 001288301 NP 032586Lokus UCSC Hr 18 13 88 13 92 MbHr 18 68 54 68 56 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVF KNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFET TADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVV LTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLA RSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPY CACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv Lokalizovanij u klitinnij membrani membrani LiteraturaMountjoy K G Robbins L S Mortrud M Cone R D 1992 The cloning of a family of genes that encode the melanocortin receptors Science 257 1248 1251 PMID 1325670 DOI 10 1126 science 1325670 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Sebag J A Hinkle P M 2010 Regulation of G protein coupled receptor signaling specific dominant negative effects of melanocortin 2 receptor accessory protein 2 Sci Signal 3 RA28 RA28 PMID 20371771 DOI 10 1126 scisignal 2000593 Clark A J L McLoughlin L Grossman A 1993 Familial glucocorticoid deficiency associated with point mutation in the adrenocorticotropin receptor Lancet 341 461 462 PMID 8094489 DOI 10 1016 0140 6736 93 90208 X Tsigos C Arai K Hung W Chrousos G P 1993 Hereditary isolated glucocorticoid deficiency is associated with abnormalities of the adrenocorticotropin receptor gene J Clin Invest 92 2458 2461 PMID 8227361 DOI 10 1172 JCI116853 Fluck C E Martens J W M Conte F A Miller W L 2002 Clinical genetic and functional characterization of adrenocorticotropin receptor mutations using a novel receptor assay J Clin Endocrinol Metab 87 4318 4323 PMID 12213892 DOI 10 1210 jc 2002 020501PrimitkiSpoluki yaki fizichno vzayemodiyut z MC2R pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6930 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 25 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 18 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi