Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

MBD3 англ Methyl CpG binding domain protein 3 білок який кодується однойменним геном розташованим у людей на короткому п

MBD3

MBD3

MBD3 (англ. Methyl-CpG binding domain protein 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 291 амінокислот, а молекулярна маса — 32 844.

MBD3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MBD3, methyl-CpG binding domain protein 3
Зовнішні ІД OMIM: 603573 MGI: 1333812 HomoloGene: 2917 GeneCards: MBD3
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
53615
17192
Ensembl
ENSG00000071655
ENSMUSG00000035478
UniProt
O95983
Q9Z2D8
RefSeq (мРНК)
NM_003926
NM_001281453
NM_001281454
NM_013595
NM_001306143
RefSeq (білок)
NP_001268382
NP_001268383
NP_001293072
NP_038623
Локус (UCSC) Хр. 19: 1.57 – 1.59 Mb Хр. 10: 80.23 – 80.24 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA
RYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALP
VRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFD
IAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAV
EKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAH
VEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.

Література

  • Hendrich B., Bird A. (1998). Identification and characterization of a family of mammalian methyl-CpG binding proteins. Mol. Cell. Biol. 18: 6538—6547. PMID 9774669 DOI:10.1128/MCB.18.11.6538
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Tatematsu K., Yamazaki T., Ishikawa F. (2000). MBD2-MBD3 complex binds to hemi-methylated DNA and forms a complex containing DNMT1 at the replication foci in late S phase. Genes Cells. 5: 677—688. PMID 10947852 DOI:10.1046/j.1365-2443.2000.00359.x
  • Saito M., Ishikawa F. (2002). The mCpG-binding domain of human MBD3 does not bind to mCpG but interacts with NuRD/Mi2 components HDAC1 and MTA2. J. Biol. Chem. 277: 35434—35439. PMID 12124384 DOI:10.1074/jbc.M203455200
  • Brackertz M., Boeke J., Zhang R., Renkawitz R. (2002). Two highly related p66 proteins comprise a new family of potent transcriptional repressors interacting with MBD2 and MBD3. J. Biol. Chem. 277: 40958—40966. PMID 12183469 DOI:10.1074/jbc.M207467200

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 10 вересня 2017. Процитовано 12 вересня 2017.
  4. (англ.) . Архів оригіналу за 11 листопада 2017. Процитовано 12 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

MBD3 angl Methyl CpG binding domain protein 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 291 aminokislot a molekulyarna masa 32 844 MBD3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2MB7IdentifikatoriSimvoliMBD3 methyl CpG binding domain protein 3Zovnishni ID OMIM 603573 MGI 1333812 HomoloGene 2917 GeneCards MBD3Ontologiya genaMolekulyarna funkciya methyl CpG binding DNA binding nucleosomal DNA binding GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding GO 0001948 GO 0016582 protein binding chromatin binding histone deacetylase activityKlitinna komponenta klitinne yadro nukleoplazma GO 0035328 Geterohromatin hromosoma NuRD complex citoplazma Hromatin GO 0009327 protein containing complexBiologichnij proces response to estradiol gistogenez embryonic organ development regulation of DNA methylation in utero embryonic development GO 1904578 response to organic cyclic compound GO 0009373 regulation of transcription DNA templated heart development DNA methylation dependent heterochromatin assembly histone acetylation GO 1901227 negative regulation of transcription by RNA polymerase II GO 0010260 starinnya lyudini brain development response to nutrient levels transcription DNA templated regulation of signal transduction by p53 class mediator histone deacetylationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez53615 17192Ensembl ENSG00000071655 ENSMUSG00000035478UniProt O95983 Q9Z2D8RefSeq mRNK NM 003926 NM 001281453 NM 001281454NM 013595 NM 001306143RefSeq bilok NP 001268382 NP 001268383NP 001293072 NP 038623Lokus UCSC Hr 19 1 57 1 59 MbHr 10 80 23 80 24 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA RYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALP VRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFD IAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAV EKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAH VEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri hromosomah LiteraturaHendrich B Bird A 1998 Identification and characterization of a family of mammalian methyl CpG binding proteins Mol Cell Biol 18 6538 6547 PMID 9774669 DOI 10 1128 MCB 18 11 6538 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Tatematsu K Yamazaki T Ishikawa F 2000 MBD2 MBD3 complex binds to hemi methylated DNA and forms a complex containing DNMT1 at the replication foci in late S phase Genes Cells 5 677 688 PMID 10947852 DOI 10 1046 j 1365 2443 2000 00359 x Saito M Ishikawa F 2002 The mCpG binding domain of human MBD3 does not bind to mCpG but interacts with NuRD Mi2 components HDAC1 and MTA2 J Biol Chem 277 35434 35439 PMID 12124384 DOI 10 1074 jbc M203455200 Brackertz M Boeke J Zhang R Renkawitz R 2002 Two highly related p66 proteins comprise a new family of potent transcriptional repressors interacting with MBD2 and MBD3 J Biol Chem 277 40958 40966 PMID 12183469 DOI 10 1074 jbc M207467200PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 10 veresnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 11 listopada 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ