MAPRE1 (англ. Microtubule associated protein RP/EB family member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 268 амінокислот, а молекулярна маса — 29 999.
MAPRE1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | MAPRE1, EB1, microtubule associated protein RP/EB family member 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 603108 MGI: 891995 HomoloGene: 56129 GeneCards: MAPRE1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 20: 32.82 – 32.85 Mb | Хр. 2: 153.58 – 153.62 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAVNVYSTSV | TSDNLSRHDM | LAWINESLQL | NLTKIEQLCS | GAAYCQFMDM | ||||
LFPGSIALKK | VKFQAKLEHE | YIQNFKILQA | GFKRMGVDKI | IPVDKLVKGK | ||||
FQDNFEFVQW | FKKFFDANYD | GKDYDPVAAR | QGQETAVAPS | LVAPALNKPK | ||||
KPLTSSSAAP | QRPISTQRTA | AAPKAGPGVV | RKNPGVGNGD | DEAAELMQQV | ||||
NVLKLTVEDL | EKERDFYFGK | LRNIELICQE | NEGENDPVLQ | RIVDILYATD | ||||
EGFVIPDEGG | PQEEQEEY |
Задіяний у таких біологічних процесах як клітинний цикл, поділ клітини, мітоз. Локалізований у цитоплазмі, цитоскелеті.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Berrueta L., Tirnauer J.S., Schuyler S.C., Pellman D., Bierer B.E. (1999). The APC-associated protein EB1 associates with components of the dynactin complex and cytoplasmic dynein intermediate chain. Curr. Biol. 9: 425—428. PMID 10226031 DOI:10.1016/S0960-9822(99)80190-0
- Nakamura M., Zhen Zhou X., Kishi S., Ping Lu K. (2002). Involvement of the telomeric protein Pin2/TRF1 in the regulation of the mitotic spindle. FEBS Lett. 514: 193—198. PMID 11943150 DOI:10.1016/S0014-5793(02)02363-3
- Askham J.M., Vaughan K.T., Goodson H.V., Morrison E.E. (2002). Evidence that an interaction between EB1 and p150(Glued) is required for the formation and maintenance of a radial microtubule array anchored at the centrosome. Mol. Biol. Cell. 13: 3627—3645. PMID 12388762 DOI:10.1091/mbc.E02-01-0061
- Bu W., Su L.-K. (2003). Characterization of functional domains of human EB1 family proteins. J. Biol. Chem. 278: 49721—49731. PMID 14514668 DOI:10.1074/jbc.M306194200
- Lazarus J.E., Moughamian A.J., Tokito M.K., Holzbaur E.L. (2013). Dynactin subunit p150(Glued) is a neuron-specific anti-catastrophe factor. PLoS Biol. 11: E1001611—E1001611. PMID 23874158 DOI:10.1371/journal.pbio.1001611
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 8 вересня 2015. Процитовано 6 лютого 2017.
- (англ.) . Архів оригіналу за 2 лютого 2017. Процитовано 6 лютого 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
MAPRE1 angl Microtubule associated protein RP EB family member 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 268 aminokislot a molekulyarna masa 29 999 MAPRE1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1PA7 1TXQ 1UEG 1VKA 1WU9 1YIB 1YIG 2HKQ 2HL3 2HL5 2QJZ 2R8U 3GJO 3MTU 3TQ7 4XA1 4XA3 4XA6IdentifikatoriSimvoliMAPRE1 EB1 microtubule associated protein RP EB family member 1Zovnishni ID OMIM 603108 MGI 891995 HomoloGene 56129 GeneCards MAPRE1Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding microtubule binding protein C terminus binding microtubule plus end binding identical protein binding RNA binding cadherin binding protein kinase bindingKlitinna komponenta microtubule plus end microtubule cytoskeleton centr organizaciyi mikrotrubochok cortical microtubule cytoskeleton cell projection membrane kompleks Goldzhi centrosoma citoskelet cell projection vereteno podilu cytoplasmic microtubule gialoplazma mikrotrubochka citoplazma focal adhesion spindle midzone mitotic spindle astral microtubule endBiologichnij proces G2 M transition of mitotic cell cycle positive regulation of microtubule plus end binding proliferaciya negative regulation of microtubule polymerization podil klitini klitinnij cikl protein localization to microtubule sister chromatid cohesion negative regulation of microtubule binding positive regulation of cell migration ciliary basal body plasma membrane docking regulation of microtubule cytoskeleton organization regulation of G2 M transition of mitotic cell cycle GO 0034613 protein localization cell migration regulation of microtubule polymerization or depolymerization positive regulation of microtubule polymerization spindle assembly protein localization to microtubule plus endDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez22919 13589Ensembl ENSG00000101367 ENSMUSG00000027479UniProt Q15691 Q61166RefSeq mRNK NM 012325NM 007896RefSeq bilok NP 036457NP 031922Lokus UCSC Hr 20 32 82 32 85 MbHr 2 153 58 153 62 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDM LFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGK FQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPK KPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQV NVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATD EGFVIPDEGGPQEEQEEY A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak klitinnij cikl podil klitini mitoz Lokalizovanij u citoplazmi citoskeleti LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Berrueta L Tirnauer J S Schuyler S C Pellman D Bierer B E 1999 The APC associated protein EB1 associates with components of the dynactin complex and cytoplasmic dynein intermediate chain Curr Biol 9 425 428 PMID 10226031 DOI 10 1016 S0960 9822 99 80190 0 Nakamura M Zhen Zhou X Kishi S Ping Lu K 2002 Involvement of the telomeric protein Pin2 TRF1 in the regulation of the mitotic spindle FEBS Lett 514 193 198 PMID 11943150 DOI 10 1016 S0014 5793 02 02363 3 Askham J M Vaughan K T Goodson H V Morrison E E 2002 Evidence that an interaction between EB1 and p150 Glued is required for the formation and maintenance of a radial microtubule array anchored at the centrosome Mol Biol Cell 13 3627 3645 PMID 12388762 DOI 10 1091 mbc E02 01 0061 Bu W Su L K 2003 Characterization of functional domains of human EB1 family proteins J Biol Chem 278 49721 49731 PMID 14514668 DOI 10 1074 jbc M306194200 Lazarus J E Moughamian A J Tokito M K Holzbaur E L 2013 Dynactin subunit p150 Glued is a neuron specific anti catastrophe factor PLoS Biol 11 E1001611 E1001611 PMID 23874158 DOI 10 1371 journal pbio 1001611PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 8 veresnya 2015 Procitovano 6 lyutogo 2017 angl Arhiv originalu za 2 lyutogo 2017 Procitovano 6 lyutogo 2017 Div takozhHromosoma 20 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi