Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
MAPK3 (англ. Mitogen-activated protein kinase 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми. Довжина поліпептидного ланцюга білка становить 379 амінокислот, а молекулярна маса — 43 136.
| MAPK3 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | MAPK3, ERK-1, ERK1, ERT2, HS44KDAP, HUMKER1A, P44ERK1, P44MAPK, PRKM3, p44-ERK1, p44-MAPK, mitogen-activated protein kinase 3 | ||||||||||||||||
| Зовнішні ІД | OMIM: 601795 MGI: 1346859 HomoloGene: 55682 GeneCards: MAPK3 | ||||||||||||||||
| Реагує на сполуку | |||||||||||||||||
| ravoxertinib, ulixertinib | |||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 16: 30.11 – 30.12 Mb | Хр. 7: 126.36 – 126.36 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MAAAAAQGGG | GGEPRRTEGV | GPGVPGEVEM | VKGQPFDVGP | RYTQLQYIGE | ||||
| GAYGMVSSAY | DHVRKTRVAI | KKISPFEHQT | YCQRTLREIQ | ILLRFRHENV | ||||
| IGIRDILRAS | TLEAMRDVYI | VQDLMETDLY | KLLKSQQLSN | DHICYFLYQI | ||||
| LRGLKYIHSA | NVLHRDLKPS | NLLINTTCDL | KICDFGLARI | ADPEHDHTGF | ||||
| LTEYVATRWY | RAPEIMLNSK | GYTKSIDIWS | VGCILAEMLS | NRPIFPGKHY | ||||
| LDQLNHILGI | LGSPSQEDLN | CIINMKARNY | LQSLPSKTKV | AWAKLFPKSD | ||||
| SKALDLLDRM | LTFNPNKRIT | VEEALAHPYL | EQYYDPTDEP | VAEEPFTFAM | ||||
| ELDDLPKERL | KELIFQETAR | FQPGVLEAP |
Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, взаємодія хазяїн-вірус, клітинний цикл, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, ядрі, мембрані.
Література
- Charest D.L., Jirik F., Harder K., Pelech S.L., Mordret G. (1993). Molecular cloning, expression, and characterization of the human mitogen-activated protein kinase p44erk1. Mol. Cell. Biol. 13: 4679—4690. PMID 7687743 DOI:10.1128/MCB.13.8.4679
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Owaki H., Makar R., Boulton T.G., Cobb M.H., Geppert T.D. (1992). Extracellular signal-regulated kinases in T cells: characterization of human ERK1 and ERK2 cDNAs. Biochem. Biophys. Res. Commun. 182: 1416—1422. PMID 1540184 DOI:10.1016/0006-291X(92)91891-S
- Gonzalez F.A., Raden D.L., Rigby M.R., Davis R.J. (1992). Heterogeneous expression of four MAP kinase isoforms in human tissues. FEBS Lett. 304: 170—178. PMID 1319925 DOI:10.1016/0014-5793(92)80612-K
- Fukunaga R., Hunter T. (1997). MNK1, a new MAP kinase-activated protein kinase, isolated by a novel expression screening method for identifying protein kinase substrates. EMBO J. 16: 1921—1933. PMID 9155018 DOI:10.1093/emboj/16.8.1921
- Ni H., Wang X.S., Diener K., Yao Z. (1998). MAPKAPK5, a novel mitogen-activated protein kinase (MAPK)-activated protein kinase, is a substrate of the extracellular-regulated kinase (ERK) and p38 kinase. Biochem. Biophys. Res. Commun. 243: 492—496. PMID 9480836 DOI:10.1006/bbrc.1998.8135
Примітки
- Сполуки, які фізично взаємодіють з mitogen-activated protein kinase 3 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 18 червня 2017. Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 16 вересня 2017. Процитовано 11 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
MAPK3 angl Mitogen activated protein kinase 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 16 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 379 aminokislot a molekulyarna masa 43 136 MAPK3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2ZOQ 4QTBIdentifikatoriSimvoliMAPK3 ERK 1 ERK1 ERT2 HS44KDAP HUMKER1A P44ERK1 P44MAPK PRKM3 p44 ERK1 p44 MAPK mitogen activated protein kinase 3Zovnishni ID OMIM 601795 MGI 1346859 HomoloGene 55682 GeneCards MAPK3Reaguye na spolukuravoxertinib ulixertinib Ontologiya genaMolekulyarna funkciya phosphatase binding ATP binding protein kinase activity MAP kinase activity transferase activity phosphotyrosine residue binding scaffold protein binding GO 0001948 GO 0016582 protein binding nucleotide binding kinase activity protein serine threonine kinase activity MAP kinase kinase activity identical protein bindingKlitinna komponenta gialoplazma nuclear envelope focal adhesion mitohondriya citoskelet klitinne yadro late endosome kompleks Goldzhi early endosome Psevdopodiya nukleoplazma citoplazma klitinna membrana caveola membrana GO 0009327 protein containing complexBiologichnij proces caveolin mediated endocytosis positive regulation of protein phosphorylation positive regulation of telomere capping response to exogenous dsRNA cardiac neural crest cell development involved in heart development positive regulation of xenophagy positive regulation of translation cellular response to DNA damage stimulus platelet activation Fc epsilon receptor signaling pathway protein phosphorylation cellular response to mechanical stimulus face development GO 0033129 positive regulation of histone modification regulation of DNA binding transcription factor activity DNA damage induced protein phosphorylation positive regulation of ERK1 and ERK2 cascade animal organ morphogenesis klitinnij cikl GO 0097285 apoptoz Fc gamma receptor signaling pathway involved in phagocytosis thymus development ERK1 and ERK2 cascade negative regulation of apolipoprotein binding transcription DNA templated cartilage development GO 0022415 viral process response to toxic substance regulation of stress activated MAPK cascade fosforilyuvannya outer ear morphogenesis BMP signaling pathway response to lipopolysaccharide thyroid gland development response to epidermal growth factor positive regulation of MAP kinase activity positive regulation of telomerase activity peptidyl tyrosine autophosphorylation sensory perception of pain positive regulation of cyclase activity trachea formation lipopolysaccharide mediated signaling pathway GO 0007243 intracellular signal transduction lung morphogenesis neural crest cell development transcription initiation from RNA polymerase I promoter regulation of early endosome to late endosome transport positive regulation of telomere maintenance via telomerase MAPK cascade positive regulation of histone acetylation axon guidance interleukin 1 mediated signaling pathway fibroblast growth factor receptor signaling pathway GO 0035404 peptidyl serine phosphorylation regulation of cellular response to heat Bergmann glial cell differentiation regulation of Golgi inheritance arachidonic acid metabolic process regulation of cytoskeleton organization GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II regulation of phosphatidylinositol 3 kinase signaling regulation of ossification GO 1901313 positive regulation of gene expression positive regulation of macrophage chemotaxis cellular response to amino acid starvation GO 0072353 cellular response to reactive oxygen species stress activated MAPK cascade cellular response to cadmium ion cellular response to dopamine positive regulation of metallopeptidase activity regulation of cellular pH GO 0034622 protein containing complex assembly cellular response to tumor necrosis factor regulyaciya ekspresiyi geniv cellular response to organic substance GO 0010260 starinnya lyudini decidualizationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5595 26417Ensembl ENSG00000102882 ENSMUSG00000063065UniProt P27361 Q63844RefSeq mRNK NM 001040056 NM 001109891 NM 002746NM 011952RefSeq bilok NP 001035145 NP 001103361 NP 002737NP 036082Lokus UCSC Hr 16 30 11 30 12 MbHr 7 126 36 126 36 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGE GAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENV IGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQI LRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGF LTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHY LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAM ELDDLPKERLKELIFQETARFQPGVLEAP A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz serin treoninovih proteyinkinaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz vzayemodiya hazyayin virus klitinnij cikl acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami Lokalizovanij u citoplazmi yadri membrani LiteraturaCharest D L Jirik F Harder K Pelech S L Mordret G 1993 Molecular cloning expression and characterization of the human mitogen activated protein kinase p44erk1 Mol Cell Biol 13 4679 4690 PMID 7687743 DOI 10 1128 MCB 13 8 4679 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Owaki H Makar R Boulton T G Cobb M H Geppert T D 1992 Extracellular signal regulated kinases in T cells characterization of human ERK1 and ERK2 cDNAs Biochem Biophys Res Commun 182 1416 1422 PMID 1540184 DOI 10 1016 0006 291X 92 91891 S Gonzalez F A Raden D L Rigby M R Davis R J 1992 Heterogeneous expression of four MAP kinase isoforms in human tissues FEBS Lett 304 170 178 PMID 1319925 DOI 10 1016 0014 5793 92 80612 K Fukunaga R Hunter T 1997 MNK1 a new MAP kinase activated protein kinase isolated by a novel expression screening method for identifying protein kinase substrates EMBO J 16 1921 1933 PMID 9155018 DOI 10 1093 emboj 16 8 1921 Ni H Wang X S Diener K Yao Z 1998 MAPKAPK5 a novel mitogen activated protein kinase MAPK activated protein kinase is a substrate of the extracellular regulated kinase ERK and p38 kinase Biochem Biophys Res Commun 243 492 496 PMID 9480836 DOI 10 1006 bbrc 1998 8135PrimitkiSpoluki yaki fizichno vzayemodiyut z mitogen activated protein kinase 3 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 18 chervnya 2017 Procitovano 11 veresnya 2017 angl Arhiv originalu za 16 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 16 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi